SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAL003W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL003W
Domain Number 1 Region: 118-206
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.49e-33
Family eEF-1beta-like 0.00000295
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000237
Family Glutathione S-transferase (GST), C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YAL003W   Gene: YAL003W   Transcript: YAL003W
Sequence length 206
Comment pep:known chromosome:R64-1-1:I:142174:143160:1 gene:YAL003W transcript:YAL003W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKAD
EFDSFPAASAAAAEEEEDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAK
SIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVS
LDDLQQSIEEDEDHVQSTDIAAMQKL
Download sequence
Identical sequences N1P7L5 P32471
YAL003W NP_009398.1.97178 YAL003W YAL003W YAL003W YAL003W 4932.YAL003W YAL003w___KOG1668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]