SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL035C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL035C
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.37e-26
Family Thioltransferase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YCL035C   Gene: YCL035C   Transcript: YCL035C
Sequence length 110
Comment pep:known chromosome:R64-1-1:III:60841:61173:-1 gene:YCL035C transcript:YCL035C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGA
DIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN
Download sequence
Identical sequences A0A0L8VUS0 A0A250WNR5 A6ZTF5 B3LU47 C7GSZ2 C8Z454 E7KA03 E7KKS3 E7NFA8 E7QC09 G2W9Z0 H0GD31 N1P7Z5 P25373
YCL035C 4932.YCL035C YCL035C YCL035C YCL035C YCL035C YCL035C SCRT_05374 YCL035C NP_009895.1.97178 YCL035C YCL035C YCL035C YCL035C YCL035C YCL035C YCL035C YCL035C YCL035C tr|A6ZTF5|A6ZTF5_YEAS7 YCL035C YCL035C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]