SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL010W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL010W
Domain Number 1 Region: 126-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-19
Family Thioltransferase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YDL010W   Gene: YDL010W   Transcript: YDL010W
Sequence length 231
Comment pep:known chromosome:R64-1-1:IV:432330:433025:1 gene:YDL010W transcript:YDL010W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYA
AMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS
LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN
Download sequence
Identical sequences N1P687 Q12438
YDL010W YDL010W 4932.YDL010W YDL010W YDL010W NP_010274.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]