SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR154C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR154C
Domain Number 1 Region: 182-332
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.05e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 15-67,133-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000221
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YGR154C   Gene: YGR154C   Transcript: YGR154C
Sequence length 356
Comment pep:known chromosome:R64-1-1:VII:796798:797868:-1 gene:YGR154C transcript:YGR154C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSYKGTISKTHSVFKPEKGRYYIYGALGCPFTHRAILARSLKKLEPVLGLVLSHWQLD
SKGARFLPAPHRPEKYKERFFTATGGIASAKLDESEELGDVNNDSARLFVDGAFDPVENI
SRLSELYYLNDPKYPGTKFTVPVLWDSKTRKIVNNESGDIIRILNSGVFDEFIQSEETNV
IDLVPHDLIDEIDKNIKWVHPKINLGVYKVGLAENGKIYETEVKTLFENLQKMECVLKEN
YKRLEEQFSGNKQKILAKYFVLGQRLTEADIRLYPSIIRFDVVYVQHFKCNLKTIRDGFP
YLHLWLINLYWNYAEFRFTTDFNHIKLFYIRMEVSRNKINQFGIVPLGPKPDISRL
Download sequence
Identical sequences N1P446 P48239
YGR154C YGR154c YGR154C YGR154C YGR154C YGR154C YGR154C YGR154C NP_011670.3.97178 4932.YGR154C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]