SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR201C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR201C
Domain Number 1 Region: 83-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.5e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0000864
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000961
Family Glutathione S-transferase (GST), N-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YGR201C   Gene: YGR201C   Transcript: YGR201C
Sequence length 225
Comment pep:known chromosome:R64-1-1:VII:902520:903197:-1 gene:YGR201C transcript:YGR201C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDGTLFTDLKERKLIRTIVPRGLVRSLKLDVKLADPSDAQQLYEREFPLRKYPTFVGPH
DEWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVF
FPLIGVKPYNATEFKAARENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFI
SFFDETWRSKHPEVTRWFNRVIKSRFFEGEFESFKMCETEMQPIK
Download sequence
Identical sequences N1P3Y2 P42936
4932.YGR201C YGR201C YGR201C NP_011717.4.97178 YGR201C YGR201C YGR201C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]