SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL167C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL167C
Domain Number - Region: 39-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000604
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YKL167C   Gene: YKL167C   Transcript: YKL167C
Sequence length 137
Comment pep:known chromosome:R64-1-1:XI:133721:134134:-1 gene:YKL167C transcript:YKL167C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVAQQLKFLNKISATTRLPQILVDPKKYSGLRLTFQTKNHNGHMGARVFWHNYLPTLQ
FYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEGSVVETIDMRNKMHEDIMKDLLDKIEHV
PLPENEIIRVGPQESII
Download sequence
Identical sequences A6ZZF7 G2WHM4 N1P0N8 P32388
4932.YKL167C YKL167C YKL167C tr|A6ZZF7|A6ZZF7_YEAS7 YKL167C YKL167C YKL167C YKL167C YKL167C NP_012754.1.97178 YKL167C YTYst217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]