SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML050W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML050W
Domain Number 1 Region: 211-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000939
Family Thioredoxin-like 2Fe-2S ferredoxin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YML050W   Gene: YML050W   Transcript: YML050W
Sequence length 311
Comment pep:known chromosome:R64-1-1:XIII:173139:174074:1 gene:YML050W transcript:YML050W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRITVKTLQQRASFHHSFKHISVPDLHTRAQNDQTNCYCQEINARLPSKTDPLDPHIKL
PHRTPNYNKHVLLLSPGDRFAQPWKVAWNHNLDTNTNRPYNAISKLRSHLGGSPGILINA
VHLQNEFIPRPKQHDEWLYFFVIPDMKLYVIKETDIEEFASFLDEGAIQAPKLSFQDYLS
GKAKASQQVHEVHHRKLTRFQGETFLRDWNLVCGHYKRDAKCGEMGPDIIAAFQDEKLFP
ENNLALISHIGGHIFAGNVIFYKLFGREKMQNKLDSLWFGKVYPHNLKLLCENLENGKII
DEMYRGGISMN
Download sequence
Identical sequences A0A0L8VK12 A6ZM17 C7GS66 C8ZEF8 E7NLA4 E7Q7I9 H0GLT3 N1P692 Q04689
YML050W YML050W YML050W YML050W YML050W YML050W 4932.YML050W YT269 YML050W YML050W YML050W YML050W NP_013662.1.97178 YML050W tr|A6ZM17|A6ZM17_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]