SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR267W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR267W
Domain Number 1 Region: 34-310
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.81e-93
Family Inorganic pyrophosphatase 0.0000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YMR267W   Gene: YMR267W   Transcript: YMR267W
Sequence length 310
Comment pep:known chromosome:R64-1-1:XIII:801772:802704:1 gene:YMR267W transcript:YMR267W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLRMNALTSKARSIERLKQTLNILSIRNHRQFSTIQQGSKYTLGFKKYLTLLNGEVGS
FFHDVPLDLNEHEKTVNMIVEVPRWTTGKFEISKELRFNPIVQDTKNGKLRFVNNIFPYH
GYIHNYGAIPQTWEDPTIEHKLGKCDVALKGDNDPLDCCEIGSDVLEMGSIKKVKVLGSL
ALIDDGELDWKVIVIDVNDPLSSKIDDLEKIEEYFPGILDTTREWFRKYKVPAGKPLNSF
AFHEQYQNSNKTIQTIKKCHNSWKNLISGSLQEKYDNLPNTERAGNGVTLEDSVKPPSQI
PPEVQKWYYV
Download sequence
Identical sequences A0A0L8VJ87 B3LMF4 B5VQ31 C8ZFD3 E7KT16 E7LYZ8 E7NLU4 P28239
SCRT_02162 NP_013994.1.97178 XP_015332510.1.40921 YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W 4932.YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W YMR267W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]