SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL088C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL088C
Domain Number 1 Region: 23-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000325
Family PDI-like 0.028
Further Details:      
 
Weak hits

Sequence:  YOL088C
Domain Number - Region: 129-181
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0209
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YOL088C   Gene: YOL088C   Transcript: YOL088C
Sequence length 277
Comment pep:known chromosome:R64-1-1:XV:153912:154745:-1 gene:YOL088C transcript:YOL088C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHGFLFSVLSTCVVILPALAYSEAVTMVKSIEQYFDICNRNDSYTMIKYYTSWCQHCK
TLAPVYEELGELYAKKANKDDTPINFLEVNCEFFGPTLCTDLPGFPIIELVKPRTKPLVL
PKLDWSSMKFHERLWQRIKTWFNNPKYQLDTSRVVRFEGSRNLKSLSNFIDTVRSKDTEE
RFIEHIFDDSRNCNEELRSQQLLCKAGKEYYSDTLSKLYGDVNGLEKERRRLEALIKQNG
DDLSKEVKEKLKIIRLQLSLLSHIEDQLEDTSSHDEL
Download sequence
Identical sequences N1NX63 Q99316
4932.YOL088C YOL088C YOL088C YOL088C YOL088C NP_014553.1.97178 YOL088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]