SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL156C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPL156C
Domain Number - Region: 162-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0917
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YPL156C   Gene: YPL156C   Transcript: YPL156C
Sequence length 284
Comment pep:known chromosome:R64-1-1:XVI:255913:256767:-1 gene:YPL156C transcript:YPL156C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEE
SEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQSEVEVDIPEPSSKATSKFSSR
SFQTDNVVTATTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADS
IFLKNLLQREFEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNG
ISVINRGMVRDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS
Download sequence
Identical sequences N1P1F1 Q12498
NP_015169.1.97178 YPL156C YPL156C YPL156C YPL156C YPL156C 4932.YPL156C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]