SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR060W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR060W
Domain Number 1 Region: 10-66
Classification Level Classification E-value
Superfamily TPR-like 8.21e-17
Family SCOPe 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YCR060W   Gene: YCR060W   Transcript: YCR060W
Sequence length 111
Comment pep:known chromosome:R64-1-1:III:224399:224734:1 gene:YCR060W transcript:YCR060W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM
CQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Download sequence
Identical sequences A0A0L8VUI0 A6ZTN6 B3LUC0 C8Z4E9 E7KA60 E7Q1G2 P25638
YCR060W 4932.YCR060W YCR060W YCR060W YCR060W 2l6j_A 4cgq_A YCR060W SCRT_05453 000145937|e2l6jA1|109.4.1.114|A:1-111 YCR060W YCR060W YCR060W YCR060W YCR060W tr|A6ZTN6|A6ZTN6_YEAS7 NP_009986.1.97178 YCR060W APC7675 YCR060W YCR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]