SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER148W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER148W
Domain Number 1 Region: 151-235
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.37e-54
Family TATA-box binding protein (TBP), C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 66-145
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.96e-52
Family TATA-box binding protein (TBP), C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YER148W   Gene: YER148W   Transcript: YER148W
Sequence length 240
Comment pep:known chromosome:R64-1-1:V:465303:466025:1 gene:YER148W transcript:YER148W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSAT
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK
MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG
TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Download sequence
Identical sequences A0A0L8VRF1 A6ZRA5 B3LRR1 C7GQ48 C8Z7H0 E7KBY2 E7KMU6 E7LTU5 E7NH33 E7QE34 G2WD35 G4XSG8 H0GFF4 N1P3M9 P13393
ORFP:6417 YER148W SCRT_04623 YER148W YER148W YER148W 1rm1_A 5fyw_O 5fz5_O 5oqj_O 5oqm_O 5sva_j 6eu0_Y 6f40_U 6f41_U 6f42_U 6f44_U YER148W YER148W YER148W YER148W 1rm1A YER148W YER148W YER148W YER148W YER148W YER148W YER148W tr|A6ZRA5|A6ZRA5_YEAS7 YER148W 4932.YER148W YER148W NP_011075.3.97178 YER148W YER148W YER148W YER148W YER148W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]