SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR285C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR285C
Domain Number 1 Region: 7-164
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.24e-24
Family Chaperone J-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YGR285C   Gene: YGR285C   Transcript: YGR285C
Sequence length 433
Comment pep:known chromosome:R64-1-1:VII:1061852:1063153:-1 gene:YGR285C transcript:YGR285C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLPTLTSDITVEVNSSATKTPFVRRPVEPVGKFFLQHAQRTLRNHTWSEFERIEAEKN
VKTVDESNVDPDELLFDTELADEDLLTHDARDWKTADLYAAMGLSKLRFRATESQIIKAH
RKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFETLTDSNKRAQYDSCDFVADVPPPKKGT
DYDFYEAWGPVFEAEARFSKKTPIPSLGNKDSSKKEVEQFYAFWHRFDSWRTFEFLDEDV
PDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLVERAVSEDPRIKMFKEEEKKEKERR
KWEREAGARAEAEAKAKAEAEAKAKAESEAKANASAKADKKKAKEAAKAAKKKNKRAIRN
SAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVD
SGKLPSSLLSYFV
Download sequence
Identical sequences N1P9Z9 P32527
NP_011801.1.97178 YGR285C YGR285C YGR285C 4932.YGR285C YGR285C YGR285C YGR285C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]