SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR117W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR117W
Domain Number 1 Region: 344-509
Classification Level Classification E-value
Superfamily TPR-like 1.14e-28
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 
Domain Number 2 Region: 125-219
Classification Level Classification E-value
Superfamily TPR-like 6.51e-26
Family Tetratricopeptide repeat (TPR) 0.00082
Further Details:      
 
Domain Number 3 Region: 477-588
Classification Level Classification E-value
Superfamily TPR-like 0.000000036
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YHR117W   Gene: YHR117W   Transcript: YHR117W
Sequence length 639
Comment pep:known chromosome:R64-1-1:VIII:342349:344268:1 gene:YHR117W transcript:YHR117W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG
QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP
SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN
LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ
MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML
Download sequence
Identical sequences A0A0L8VPM1 N1P153 P38825
YHR117W YHR117W 4932.YHR117W YHR117W YHR117W YHR117W NP_011985.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]