SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR233C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR233C
Domain Number 1 Region: 59-583
Classification Level Classification E-value
Superfamily TPR-like 5.69e-53
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YLR233C   Gene: YLR233C   Transcript: YLR233C
Sequence length 699
Comment pep:known chromosome:R64-1-1:XII:607425:609524:-1 gene:YLR233C transcript:YLR233C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNEEVNEECMRLFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHRKSTRFLEELLL
KQENMYHNNNYERINDSVIPLVLKLLWLQIHEPTLQWFEHWFHDIMRLSNRRKFRVFRIF
QKKMIQFFKITHRYYYDIIEHLCAKYDMNSVISNALFAKLNLMQYTDGLSTHEKIILNTS
NPLTFSIVISLQRCVINLGSTHFYKTLLNKPSNKPKSVEGFEKSIRYLNIASLYLPAVGD
TYFQRAKIYLITGKFSLYFFELVRGALVRIPSKCALNNLKDFILTPDFPERRRLMKKLAI
LVSKDLKGEKSFFEGQIVLQFLSIVEHTLVPQSWNASRASNCWLLKEHLQMAALKYHSGN
INVILENLAATMGSFDLMFTTRKSKEQKNKLKYADLSERQVFFLDLSFDFIANIIDVVIK
PSWQKNMEDFRYLAIIRLLMCWIKSYRSILQYTHRHRKFCTSFALLLNDLINSPLNCSGN
IYSHRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKVLSPKE
ECVLRIRSIIFSGMKFLEKNDTGVIWNASKYKFDLISPNIKIKRQIALSEISSKINVKTQ
QERVVSSRKVEAKRDEQQRKRAGKIAVTELEKQFANVRRTKKLSPLPEKDGVSSELVKHA
ASRGRKTITGPLSSDFLSYPDEAIDADEDITVQVPDTPT
Download sequence
Identical sequences N1P6W9 P17214
YLR233C NP_013334.1.97178 4932.YLR233C YLR233C YLR233C YLR233C YLR233c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]