SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR237W from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR237W
Domain Number - Region: 363-408,494-530,557-602
Classification Level Classification E-value
Superfamily TPR-like 0.000108
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YMR237W   Gene: YMR237W   Transcript: YMR237W
Sequence length 724
Comment pep:known chromosome:R64-1-1:XIII:743749:745923:1 gene:YMR237W transcript:YMR237W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITLIKSLPSSSSTTTATASANDN
GATSNINGQDPTTIVTELHSHDKLKGQIGTFFYCMGIDTSDPTSITIFAKKITDLFLDTP
QIWFGKKKHFHVSKISISSWNAFRKYDVNIIVHIPGTVQTYIINSDGEQSQLPSVAEASS
GRNSQDLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANN
FIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHP
EAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLL
DVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYV
LRRIAPITSDENLHLPLPLDASIEEISSLNPMDVQLEQKSADPNLVNLSASSLKSTFQLA
YKLLTEIVQITGWEQLLKYRSKIFVMEDEYQGSTSSIDEAEVRGNDISKMRSKRLCERWL
DNLFMLLYEDLKTYTDWQSEQLYFDAQNSKYHKLTVEWELFGLCAKRLGHLPEAAKAFQI
GLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSANSELTSSQILSSINDIDSSIIDLVVKIC
CWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTND
TFDN
Download sequence
Identical sequences C8ZFA2 E7KSZ7 N1P0K7 Q05029
YMR237W NP_013964.1.97178 YMR237W 4932.YMR237W YMR237W YMR237W YMR237W YMR237W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]