SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL021C from Saccharomyces cerevisiae 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL021C
Domain Number 1 Region: 479-909
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-127
Family RNB domain-like 0.000000000000693
Further Details:      
 
Domain Number 2 Region: 253-398
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-36
Family Cold shock DNA-binding domain-like 0.000000105
Further Details:      
 
Domain Number 3 Region: 389-494
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-24
Family Cold shock DNA-binding domain-like 0.00000527
Further Details:      
 
Domain Number 4 Region: 912-993
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.34e-19
Family Cold shock DNA-binding domain-like 0.00000866
Further Details:      
 
Domain Number 5 Region: 86-207
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000155
Family PIN domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YOL021C   Gene: YOL021C   Transcript: YOL021C
Sequence length 1001
Comment pep:known chromosome:R64-1-1:XV:282421:285426:-1 gene:YOL021C transcript:YOL021C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVV
PDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAIDLLENPNCFFDVIVPQIVLDE
VRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQW
YSEHLKPYDINVVLVTNDRLNREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDS
FDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVL
IVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSS
NTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQ
NVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAE
TEALLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLIC
SIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKR
IDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLR
IDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKL
LATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISL
ESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYT
HFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIE
YYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNSAAFDEVEYKL
TFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLLK
Download sequence
Identical sequences C7GVF0 Q08162
YOL021C YOL021C YOL021C NYSGXRC-6391a YR71 YOL021C YOL021C 4932.YOL021C NP_014621.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]