SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL128C from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL128C
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.64e-16
Family SCOPe 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YGL128C   Gene: YGL128C   Transcript: YGL128C
Sequence length 283
Comment pep:known chromosome:EF4:VII:269293:270144:-1 gene:YGL128C transcript:YGL128C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGHELEDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSI
IHKFHLLSTATNILTNADVRPHYDRWLIEFLRKTNDIERNKLIQKLEESESSTIPTTTPH
PDLLQIQRHGELLRKLKHFNLPYGDWKHLNTQDQENASQHPYYDCSTLRIVLDNFLQSNN
KSNCLSHLRNQVFITLSANEIYDIYFSERNNYSKDDSIIIYTVFDTPITAQHVFRNWSSG
NLIPTVKDISPLIPLHYYSDFNLETELNDDIARLVSNEPILLD
Download sequence
Identical sequences B3LHI8 C8Z8C2 N1P1Q0 P52868
SCRT_01123 YGL128C YGL128C APC89506 YGL128C YGL128C YGL128C YGL128C YGL128C YGL128C 4932.YGL128C YGL128C YGL128C YGL128C 5y88_T NP_011387.2.97178 YGL128C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]