SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR198W from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR198W
Domain Number 1 Region: 465-561
Classification Level Classification E-value
Superfamily TPR-like 0.00000266
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  YGR198W
Domain Number - Region: 632-710
Classification Level Classification E-value
Superfamily TPR-like 0.0607
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number - Region: 291-566
Classification Level Classification E-value
Superfamily ARM repeat 0.0748
Family Plakophilin 1 helical region 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YGR198W   Gene: YGR198W   Transcript: YGR198W
Sequence length 817
Comment pep:known chromosome:EF4:VII:894693:897146:1 gene:YGR198W transcript:YGR198W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNSNVRIPPTVPSKIIDVVDQALRARLLGGSTFNSGFDSLDSVLNLQFRLHYHVIGSNG
PAKPVCDVLLKESQNLEKNMSMMEELNDYPEITKLVEKILFNCLGILFFHRGQFQESQRC
LLHSLKIHNNTASQKTALMEQYDRYLIVENLYYRGLVSQDINIMQNVFYKELLAHVDTIP
PESNGLLFEYISLIVAKLRFNQIQDLAENFKTTVENPFILFLYMIKKFQSPLKKHIDNDD
LYLKFGQNVLLKAKFPTASETNDEALEHFNVFLQYYFKFTHIKKIKVNPSWYNFIISSME
KTFQSIEVSKTAMFLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSHRD
IISFIDAYSFILQNSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDWLE
NSTRCVYPGNISKVLTNAWSTLYEIRKYQLDFLVSNNLTSYLCNAMMLSTKEKDNADVEE
QEEGEEEKALRELQFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSVQE
DKEMSYKIVCSVLEAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEIFGTLEALETLPEV
FELYATLFPDSQPELNSMGPKYSQTKEYLLQMVWIFAANMYMRTKDNDEDAKAAIKEASN
VESKFKNLNCNIANGYLSIIKDEPGVALKEFETVLYYDENNLDALVGFAELIFPEELGVE
ETNLERYYTLSLDKKPGKRAKLTFVNDTDRSAAYARLKFLLECAILESIEAYYSPEVWWY
LSLIYEKYQDDEYKNSLLKCIKYQELNPIRSLRYCNY
Download sequence
Identical sequences N1P9Y1 P46951
YGR198W 4932.YGR198W YGR198W YGR198W NP_011714.3.97178 YGR198W YGR198W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]