SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR129C from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR129C
Domain Number 1 Region: 217-321
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-18
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 2 Region: 68-125
Classification Level Classification E-value
Superfamily PH domain-like 0.00000822
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YBR129C   Gene: YBR129C   Transcript: YBR129C
Sequence length 328
Comment pep:known chromosome:EF4:II:494353:495339:-1 gene:YBR129C transcript:YBR129C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAGATAPSSQHEILIASNLIKKPSTSQNKTPTAQSSSGNNGAADGAPQGYHHHHHHHRH
LWWPRTTDHQYWCVLRKNQFAYYKTRDEREAISVIPRFDILNFKISELDGILTVYTPSKD
LIFKFPRGQNEKVGMELMHNWKIALEKFLSSPSGNESVTTGSDYDEEEDDDDLIVVDEKA
GPSSSKHSCSLTMDEQLSREDKEFYRMFDPRNAEHQVCSGILYTKVKKKKLFNRAKWQKF
NVELTNTSFNLYSFKTGKLKKSIKLDKIIDCIELDNNSKMKNDDTNFALITFDERLSFKA
ANDQDMVDWIINFKSGILIRKKLKAENI
Download sequence
Identical sequences A0A0L8VUZ3 B3LN27 B5VE89 D3UEM2 E7K9X7 E7QBH4 N1PAT4 P38271
YBR129c YT343 YBR129C YBR129C YBR129C YBR129C YBR129C YBR129C YBR129C SCRT_02840 YBR129C YBR129C YBR129C YBR129C YBR129C YBR129C YBR129C 4932.YBR129C NP_009687.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]