SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER041W from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER041W
Domain Number 1 Region: 2-230,267-288
Classification Level Classification E-value
Superfamily PIN domain-like 4.91e-38
Family 5' to 3' exonuclease catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 274-315,369-437
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.00000000179
Family 5' to 3' exonuclease, C-terminal subdomain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YER041W   Gene: YER041W   Transcript: YER041W
Sequence length 759
Comment pep:known chromosome:EF4:V:232461:234740:1 gene:YER041W transcript:YER041W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSQIWEFLKPYLQDSRIPLRKFVIDFNKSQKRAPRIAIDAYGWLFECGFIQNIDISAR
SRSRSRSPTRSPRDSDIDSSQEYYGSRSYTTTGKAVINFISRLKELLSLNVEFLLVFDGV
MKPSFKRKFNHEQNATTCDDEKEYYSSWEQHVKNHEVYGNCKGLLAPSDPEFISLVRKLL
DLMNISYVIACGEGEAQCVWLQVSGAVDFILSNDSDTLVFGGEKILKNYSKFYDDFGPSS
ITSHSPSRHHDSKESFVTVIDLPKINKVAGKKFDRLSLLFFSVLLGADYNRGVKGLGKNK
SLQLAQCEDPNFSMEFYDIFKDFNLEDLTSESLRKSRYRLFQKRLYLYCKDHSVELFGRN
YPVLLNQGSFEGWPSTVAIMHYFHPIVQPYFDEEVLSDKYINMAGNGHYRNLNFNELKYF
LQSLNLPQISSFDKWFHDSMHEMFLLREFLSIDESDNIGKGNMRITEEKIMNIDGGKFQI
PCFKIRYTTFLPNIPISSQSPLKRSNSPSRSKSPTRRQMDIMEHPNSLWLPKYLIPQSHP
LVIQYYETQQLIQKEKEKKGKKSNKSRLPQKNNLDEFLRKHTSPIKSIGKVGESRKEILE
PVRKRLFVDTDEDTSLEEIPAPTRLTTVDEHSDNDDDSLIFVDEITNSQSVLDSSPGKRI
RDLTQDEQVDVWKDVIEISPIKKSRTTNAEKNPPESGLKSRSSITINARLQGTKMLPPNL
TAPRLEREHSSVLDQLVTDAQDTVDRFVACDSDSSSTIE
Download sequence
Identical sequences P40028
NP_010959.2.97178 YER041W YER041W YER041W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]