SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER174C from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER174C
Domain Number 1 Region: 145-234
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-25
Family Thioltransferase 0.00032
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.98e-23
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: YER174C   Gene: YER174C   Transcript: YER174C
Sequence length 244
Comment pep:known chromosome:EF4:V:538434:539168:-1 gene:YER174C transcript:YER174C gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLS
IDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAK
GPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGI
LREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ
HALQ
Download sequence
Identical sequences N1P5G5 P32642
YER174C NP_011101.3.97178 GO.93234 YER174C YER174C YER174C YER174C 4932.YER174C YER174C YER174C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]