SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR200W from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR200W
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Prefoldin 1.07e-27
Family Prefoldin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: YLR200W   Gene: YLR200W   Transcript: YLR200W
Sequence length 114
Comment pep:known chromosome:EF4:XII:549012:549356:1 gene:YLR200W transcript:YLR200W gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE
QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR
Download sequence
Identical sequences C7GIT1 N1NYD5 P52553
APC7612 YLR200W 4932.YLR200W NP_013301.1.97178 YLR200W YLR200W YLR200W YLR200W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]