SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78045354|ref|YP_361604.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78045354|ref|YP_361604.1|
Domain Number 1 Region: 110-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.69e-16
Family DsbC/DsbG C-terminal domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 36-89
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.00000000772
Family DsbC/DsbG N-terminal domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78045354|ref|YP_361604.1|
Sequence length 262
Comment disulfide isomerase/thiol-disulfide oxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MARLINAAVGIALLLTSAVVQNAQASEAPKPTLAERHLMASGVKVTHRFDSVSGLRAIVA
DNGADKRLFYVTPDGKSLIAGLVFDESGRNVTTEDMGRAGISASGNTTAVTQLQAQKLWQ
RVQGLKALKDGNRGADIYVFVDPTCQYCHRLMSMVRPYIAAGTLQVRWLPVAILSSRSPG
LAEAMYKAPNVAQAIQSVSTNMLKPVPESEAIRLQLAQNLLAMRDTGQTGVPLVVYRVGQ
RVVIKSGVPTDAELVALAGGAK
Download sequence
Identical sequences Q3C059
gi|78045354|ref|YP_361604.1| WP_011345653.1.100156 WP_011345653.1.13735 WP_011345653.1.27112 WP_011345653.1.40690 WP_011345653.1.46677 WP_011345653.1.60785 WP_011345653.1.89212 gi|78045354|ref|YP_361604.1|NC_007507 316273.XCVd0045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]