SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046498|ref|YP_362673.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046498|ref|YP_362673.1|
Domain Number 1 Region: 205-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.65e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000766
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.51e-31
Family PDI-like 0.0000818
Further Details:      
 
Domain Number 3 Region: 106-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-22
Family PDI-like 0.0000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78046498|ref|YP_362673.1|
Sequence length 530
Comment alkyl hydroperoxide reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLEGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVEARQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPATADSVAQAA
Download sequence
Identical sequences A0A0G8YQW3 A0A0N8TPG3 A0A0W7XQX4 A0A1S1XM00 G2LTN6 Q3BX40
gi|346723819|ref|YP_004850488.1| 316273.XCV0942 WP_008576352.1.100156 WP_008576352.1.100312 WP_008576352.1.101985 WP_008576352.1.102013 WP_008576352.1.10442 WP_008576352.1.11230 WP_008576352.1.12064 WP_008576352.1.12457 WP_008576352.1.1263 WP_008576352.1.12827 WP_008576352.1.13735 WP_008576352.1.14159 WP_008576352.1.14165 WP_008576352.1.15539 WP_008576352.1.16263 WP_008576352.1.17112 WP_008576352.1.17215 WP_008576352.1.19065 WP_008576352.1.19305 WP_008576352.1.19776 WP_008576352.1.199 WP_008576352.1.20043 WP_008576352.1.2014 WP_008576352.1.20169 WP_008576352.1.21227 WP_008576352.1.21303 WP_008576352.1.21317 WP_008576352.1.2230 WP_008576352.1.2259 WP_008576352.1.22888 WP_008576352.1.23342 WP_008576352.1.23534 WP_008576352.1.24172 WP_008576352.1.24624 WP_008576352.1.2476 WP_008576352.1.25231 WP_008576352.1.27112 WP_008576352.1.28321 WP_008576352.1.29361 WP_008576352.1.3003 WP_008576352.1.30677 WP_008576352.1.32205 WP_008576352.1.331 WP_008576352.1.3440 WP_008576352.1.3654 WP_008576352.1.37257 WP_008576352.1.37569 WP_008576352.1.37942 WP_008576352.1.38016 WP_008576352.1.39371 WP_008576352.1.40690 WP_008576352.1.41197 WP_008576352.1.42335 WP_008576352.1.43396 WP_008576352.1.43419 WP_008576352.1.44297 WP_008576352.1.44794 WP_008576352.1.45126 WP_008576352.1.46677 WP_008576352.1.47244 WP_008576352.1.47501 WP_008576352.1.47931 WP_008576352.1.47958 WP_008576352.1.48351 WP_008576352.1.49886 WP_008576352.1.50405 WP_008576352.1.51018 WP_008576352.1.52184 WP_008576352.1.5224 WP_008576352.1.52767 WP_008576352.1.5365 WP_008576352.1.54158 WP_008576352.1.54200 WP_008576352.1.54709 WP_008576352.1.55132 WP_008576352.1.55770 WP_008576352.1.55809 WP_008576352.1.56262 WP_008576352.1.57452 WP_008576352.1.58982 WP_008576352.1.59767 WP_008576352.1.6015 WP_008576352.1.60406 WP_008576352.1.60785 WP_008576352.1.61221 WP_008576352.1.61498 WP_008576352.1.64411 WP_008576352.1.65037 WP_008576352.1.65450 WP_008576352.1.656 WP_008576352.1.66420 WP_008576352.1.67180 WP_008576352.1.67877 WP_008576352.1.6838 WP_008576352.1.68383 WP_008576352.1.68402 WP_008576352.1.70738 WP_008576352.1.71699 WP_008576352.1.72092 WP_008576352.1.72305 WP_008576352.1.73738 WP_008576352.1.74035 WP_008576352.1.74279 WP_008576352.1.75313 WP_008576352.1.75734 WP_008576352.1.7704 WP_008576352.1.772 WP_008576352.1.77810 WP_008576352.1.78066 WP_008576352.1.78220 WP_008576352.1.78473 WP_008576352.1.79359 WP_008576352.1.79366 WP_008576352.1.79878 WP_008576352.1.79906 WP_008576352.1.80975 WP_008576352.1.81486 WP_008576352.1.81489 WP_008576352.1.83358 WP_008576352.1.83628 WP_008576352.1.85024 WP_008576352.1.85152 WP_008576352.1.86099 WP_008576352.1.8651 WP_008576352.1.87349 WP_008576352.1.88740 WP_008576352.1.89212 WP_008576352.1.89360 WP_008576352.1.89772 WP_008576352.1.90230 WP_008576352.1.9340 WP_008576352.1.94147 WP_008576352.1.94781 WP_008576352.1.94946 WP_008576352.1.95108 WP_008576352.1.96073 WP_008576352.1.96108 WP_008576352.1.96329 WP_008576352.1.97426 WP_008576352.1.98344 WP_008576352.1.9928 WP_008576352.1.99285 gi|78046498|ref|YP_362673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]