SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046499|ref|YP_362674.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046499|ref|YP_362674.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.59e-51
Family Glutathione peroxidase-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78046499|ref|YP_362674.1|
Sequence length 187
Comment alkyl hydroperoxide reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAA
FQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHKLTRAFGVHIEEEGLALR
GTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVANNPGQVCPAKWKEGAKTLAPS
LDLVGKI
Download sequence
Identical sequences A0A098Q5B0 A0A099Q0E3 A0A0A6THL9 A0A0B2CLA5 A0A0G8Z7W5 A0A0P6VWL3 A0A0Q0EF69 A0A0U5F978 A0A0W7XR68 A0A199RF07 A0A1D9EMA8 A0A1L5QW42 A0A1S1XLZ4 A0A1T1P6V7 A0A1T1QNF6 A0A1T1SNF0 A0A1U8YX99 A0A1V9H0T5 A0A220WKY2 A0A2D2SAC7 D4SVW0 D4T4J4 F0B8V3 G2LTN7 H8FJ59 M4TUF6 O06464 Q3BX39 Q79B30 U4LXW3
gi|470470838|ref|YP_007635406.1| gi|78046499|ref|YP_362674.1| gi|471269172|ref|YP_007651637.1| gi|21241677|ref|NP_641259.1| WP_003488826.1.100156 WP_003488826.1.100312 WP_003488826.1.100431 WP_003488826.1.101491 WP_003488826.1.101581 WP_003488826.1.101846 WP_003488826.1.101985 WP_003488826.1.102013 WP_003488826.1.10442 WP_003488826.1.11230 WP_003488826.1.11370 WP_003488826.1.12064 WP_003488826.1.12457 WP_003488826.1.1263 WP_003488826.1.12827 WP_003488826.1.13318 WP_003488826.1.13350 WP_003488826.1.13735 WP_003488826.1.14032 WP_003488826.1.14159 WP_003488826.1.14165 WP_003488826.1.14945 WP_003488826.1.15350 WP_003488826.1.15539 WP_003488826.1.15678 WP_003488826.1.15826 WP_003488826.1.16263 WP_003488826.1.16332 WP_003488826.1.17112 WP_003488826.1.17148 WP_003488826.1.17215 WP_003488826.1.18336 WP_003488826.1.19065 WP_003488826.1.19305 WP_003488826.1.1936 WP_003488826.1.19505 WP_003488826.1.19776 WP_003488826.1.199 WP_003488826.1.20043 WP_003488826.1.2014 WP_003488826.1.20169 WP_003488826.1.21004 WP_003488826.1.21227 WP_003488826.1.21303 WP_003488826.1.21317 WP_003488826.1.21440 WP_003488826.1.22109 WP_003488826.1.22114 WP_003488826.1.2230 WP_003488826.1.2259 WP_003488826.1.22678 WP_003488826.1.22888 WP_003488826.1.23342 WP_003488826.1.23375 WP_003488826.1.23534 WP_003488826.1.24172 WP_003488826.1.24624 WP_003488826.1.2476 WP_003488826.1.25231 WP_003488826.1.25999 WP_003488826.1.27112 WP_003488826.1.28321 WP_003488826.1.28535 WP_003488826.1.28779 WP_003488826.1.29361 WP_003488826.1.29860 WP_003488826.1.3003 WP_003488826.1.30380 WP_003488826.1.30677 WP_003488826.1.30778 WP_003488826.1.31364 WP_003488826.1.31392 WP_003488826.1.31910 WP_003488826.1.32205 WP_003488826.1.3308 WP_003488826.1.331 WP_003488826.1.34035 WP_003488826.1.3440 WP_003488826.1.35047 WP_003488826.1.35238 WP_003488826.1.35540 WP_003488826.1.35849 WP_003488826.1.3651 WP_003488826.1.3654 WP_003488826.1.37228 WP_003488826.1.37257 WP_003488826.1.37259 WP_003488826.1.37569 WP_003488826.1.37942 WP_003488826.1.38016 WP_003488826.1.38217 WP_003488826.1.39341 WP_003488826.1.39371 WP_003488826.1.39696 WP_003488826.1.40308 WP_003488826.1.40689 WP_003488826.1.40690 WP_003488826.1.41197 WP_003488826.1.41216 WP_003488826.1.41431 WP_003488826.1.42335 WP_003488826.1.42602 WP_003488826.1.42745 WP_003488826.1.43379 WP_003488826.1.43396 WP_003488826.1.43419 WP_003488826.1.43567 WP_003488826.1.43799 WP_003488826.1.43832 WP_003488826.1.44297 WP_003488826.1.44794 WP_003488826.1.45126 WP_003488826.1.45197 WP_003488826.1.46272 WP_003488826.1.46464 WP_003488826.1.46677 WP_003488826.1.47244 WP_003488826.1.47339 WP_003488826.1.47501 WP_003488826.1.47697 WP_003488826.1.47707 WP_003488826.1.47931 WP_003488826.1.47958 WP_003488826.1.48351 WP_003488826.1.48517 WP_003488826.1.49137 WP_003488826.1.49886 WP_003488826.1.50405 WP_003488826.1.51018 WP_003488826.1.51091 WP_003488826.1.52184 WP_003488826.1.52218 WP_003488826.1.5224 WP_003488826.1.52489 WP_003488826.1.52767 WP_003488826.1.53417 WP_003488826.1.5365 WP_003488826.1.53650 WP_003488826.1.54158 WP_003488826.1.54200 WP_003488826.1.54709 WP_003488826.1.55132 WP_003488826.1.55770 WP_003488826.1.55809 WP_003488826.1.55935 WP_003488826.1.56030 WP_003488826.1.56075 WP_003488826.1.56262 WP_003488826.1.56360 WP_003488826.1.56391 WP_003488826.1.56804 WP_003488826.1.57452 WP_003488826.1.57989 WP_003488826.1.58141 WP_003488826.1.58382 WP_003488826.1.58982 WP_003488826.1.59619 WP_003488826.1.59630 WP_003488826.1.59767 WP_003488826.1.6015 WP_003488826.1.60202 WP_003488826.1.60328 WP_003488826.1.60406 WP_003488826.1.60785 WP_003488826.1.61221 WP_003488826.1.61498 WP_003488826.1.61945 WP_003488826.1.61999 WP_003488826.1.62152 WP_003488826.1.62531 WP_003488826.1.6260 WP_003488826.1.63386 WP_003488826.1.63808 WP_003488826.1.64411 WP_003488826.1.65037 WP_003488826.1.65450 WP_003488826.1.656 WP_003488826.1.66420 WP_003488826.1.67180 WP_003488826.1.6771 WP_003488826.1.67877 WP_003488826.1.67913 WP_003488826.1.6829 WP_003488826.1.6838 WP_003488826.1.68383 WP_003488826.1.68402 WP_003488826.1.70026 WP_003488826.1.70193 WP_003488826.1.70738 WP_003488826.1.71126 WP_003488826.1.71284 WP_003488826.1.71353 WP_003488826.1.71699 WP_003488826.1.72092 WP_003488826.1.72305 WP_003488826.1.72777 WP_003488826.1.72810 WP_003488826.1.73738 WP_003488826.1.74035 WP_003488826.1.74121 WP_003488826.1.74279 WP_003488826.1.75313 WP_003488826.1.75734 WP_003488826.1.76206 WP_003488826.1.7704 WP_003488826.1.772 WP_003488826.1.77810 WP_003488826.1.78066 WP_003488826.1.78220 WP_003488826.1.78473 WP_003488826.1.79359 WP_003488826.1.79366 WP_003488826.1.79878 WP_003488826.1.79879 WP_003488826.1.79906 WP_003488826.1.80421 WP_003488826.1.80602 WP_003488826.1.80975 WP_003488826.1.81086 WP_003488826.1.81486 WP_003488826.1.81489 WP_003488826.1.81510 WP_003488826.1.81579 WP_003488826.1.81711 WP_003488826.1.82045 WP_003488826.1.82073 WP_003488826.1.82115 WP_003488826.1.83358 WP_003488826.1.83628 WP_003488826.1.8436 WP_003488826.1.85024 WP_003488826.1.85152 WP_003488826.1.8544 WP_003488826.1.86099 WP_003488826.1.86317 WP_003488826.1.8651 WP_003488826.1.87207 WP_003488826.1.87349 WP_003488826.1.87455 WP_003488826.1.88516 WP_003488826.1.88706 WP_003488826.1.88740 WP_003488826.1.88988 WP_003488826.1.89206 WP_003488826.1.89212 WP_003488826.1.89360 WP_003488826.1.89772 WP_003488826.1.90138 WP_003488826.1.90200 WP_003488826.1.90226 WP_003488826.1.90230 WP_003488826.1.90594 WP_003488826.1.91667 WP_003488826.1.92002 WP_003488826.1.92041 WP_003488826.1.92912 WP_003488826.1.92955 WP_003488826.1.9340 WP_003488826.1.93402 WP_003488826.1.93813 WP_003488826.1.94147 WP_003488826.1.94705 WP_003488826.1.94781 WP_003488826.1.94946 WP_003488826.1.95108 WP_003488826.1.96073 WP_003488826.1.96108 WP_003488826.1.96329 WP_003488826.1.96706 WP_003488826.1.96800 WP_003488826.1.97098 WP_003488826.1.97233 WP_003488826.1.97426 WP_003488826.1.98344 WP_003488826.1.98824 WP_003488826.1.9928 WP_003488826.1.99285 WP_003488826.1.99816 WP_003488826.1.99907 190486.XAC0907 316273.XCV0943 gi|346723820|ref|YP_004850489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]