SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046525|ref|YP_362700.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046525|ref|YP_362700.1|
Domain Number 1 Region: 6-34,68-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-33
Family Glutathione peroxidase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78046525|ref|YP_362700.1|
Sequence length 203
Comment thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MTVRLVRSACALLLPLLLLSACKPASEATPAAGNGAAPAATPQAPAAPATPADPAAPPNS
SVVQQTAQMPRLSLPTVTGETYDLAAHRGKWVVVNFWATWCAPCLKEMPELSALHTMRDT
VEVVGLAYEDITSADMQAFLKDHPVSYPIAILDPYQPPQDFATPRGLPMTYLIGPDGKVA
KQFLGPVTARDIEAAVGITGKAG
Download sequence
Identical sequences Q3BX13
WP_011346527.1.100156 WP_011346527.1.10442 WP_011346527.1.11230 WP_011346527.1.13735 WP_011346527.1.199 WP_011346527.1.21303 WP_011346527.1.21317 WP_011346527.1.2259 WP_011346527.1.23534 WP_011346527.1.27112 WP_011346527.1.29361 WP_011346527.1.3003 WP_011346527.1.37942 WP_011346527.1.39371 WP_011346527.1.40690 WP_011346527.1.43396 WP_011346527.1.44794 WP_011346527.1.46449 WP_011346527.1.46677 WP_011346527.1.49886 WP_011346527.1.55770 WP_011346527.1.60785 WP_011346527.1.64411 WP_011346527.1.66420 WP_011346527.1.67180 WP_011346527.1.67877 WP_011346527.1.772 WP_011346527.1.79359 WP_011346527.1.81489 WP_011346527.1.8544 WP_011346527.1.89212 WP_011346527.1.89360 WP_011346527.1.94946 WP_011346527.1.99285 316273.XCV0969 gi|78046525|ref|YP_362700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]