SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046630|ref|YP_362805.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046630|ref|YP_362805.1|
Domain Number 1 Region: 19-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-26
Family Thioltransferase 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78046630|ref|YP_362805.1|
Sequence length 113
Comment glutaredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSDLTPTTEFPVSQDHTDQDAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLD
PAERDRMIALAKRTSVPQIFVGDVHVGGYDDMMAMHRAGKLEPLLAGSAGGQA
Download sequence
Identical sequences Q3BWQ8
gi|78046630|ref|YP_362805.1| 316273.XCV1074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]