SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046904|ref|YP_363079.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046904|ref|YP_363079.1|
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 83-195
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78046904|ref|YP_363079.1|
Sequence length 218
Comment glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSTEIVLYTHPLSRGRVARWMLEETGLPYQAVILDYGTTMKAPDYLAINPMGKVPALRHG
EAVVTENAAICAYLADLVPERHLAPPPGSPARADYYRWLFFLAGPVEALLTAKQSGVLAP
ARSAGYGHEADLLQTLEQAIAGREYLAGACFSAADLYMAAVVGFYTRTGMLEPRPAFTAF
AQRHAARPAAVRANAADDALIAAHPNPDMPRTVDTTNT
Download sequence
Identical sequences Q3BVY4
WP_011346794.1.100156 WP_011346794.1.10442 WP_011346794.1.11230 WP_011346794.1.13735 WP_011346794.1.199 WP_011346794.1.21303 WP_011346794.1.2259 WP_011346794.1.23534 WP_011346794.1.27112 WP_011346794.1.29361 WP_011346794.1.3003 WP_011346794.1.37942 WP_011346794.1.39371 WP_011346794.1.43396 WP_011346794.1.44794 WP_011346794.1.46449 WP_011346794.1.46677 WP_011346794.1.49886 WP_011346794.1.55770 WP_011346794.1.60785 WP_011346794.1.64411 WP_011346794.1.66420 WP_011346794.1.67180 WP_011346794.1.67877 WP_011346794.1.75734 WP_011346794.1.772 WP_011346794.1.79359 WP_011346794.1.81489 WP_011346794.1.8544 WP_011346794.1.89212 WP_011346794.1.89360 WP_011346794.1.94946 WP_011346794.1.9928 WP_011346794.1.99285 316273.XCV1348 gi|78046904|ref|YP_363079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]