SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046939|ref|YP_363114.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046939|ref|YP_363114.1|
Domain Number 1 Region: 16-226
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.6e-46
Family Thioltransferase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78046939|ref|YP_363114.1|
Sequence length 242
Comment hypothetical protein XCV1383 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MLCKSQSHPTNESQLMRIDIWSDVVCPWCWIGKRRFQAALAALGAQAPALDIHYHAFQLD
PDAGLEPTPLRAALASKFGGTARVEQILAQTQATAQAEGLPLDFGRGQVQVSTLRAHRLI
WLASHEGDVDAVMEALFHAHFAEGQNVGAFDTLVRAGEAGGLTAARVQAMLESDEGTVEV
QAQLAQAAALGIRAVPSFVIDGRALIQGAQPPESFAQALLQLAAESTPVGGPDACGPDGC
VV
Download sequence
Identical sequences Q3BVU9
316273.XCV1383 gi|78046939|ref|YP_363114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]