SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047074|ref|YP_363249.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047074|ref|YP_363249.1|
Domain Number 1 Region: 82-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.39e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.16e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78047074|ref|YP_363249.1|
Sequence length 211
Comment glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MVATLYHSPSTAALVVHWLLIELDIPHALHPLDFERGEHKSPQYLALNPAGVVPTLVLDG
QVLTEAAAIVLQLADLHPQAGLAPAVGTPERAAYYKWMFFCANTLQPAYRAWFYPSEPAG
AGQAEAAQMHARRKLEAAWTQVDAHLQAHGPYLLGKTVSAADFMLTMLMRWSRNMPRPTD
TWPALRAHAMRMKARPAFQETYRREGLTDWT
Download sequence
Identical sequences Q3BVG4
316273.XCV1518 WP_011346924.1.100156 WP_011346924.1.10442 WP_011346924.1.11230 WP_011346924.1.13735 WP_011346924.1.199 WP_011346924.1.21303 WP_011346924.1.21317 WP_011346924.1.2259 WP_011346924.1.23534 WP_011346924.1.27112 WP_011346924.1.29361 WP_011346924.1.3003 WP_011346924.1.331 WP_011346924.1.37942 WP_011346924.1.39371 WP_011346924.1.40690 WP_011346924.1.43396 WP_011346924.1.44794 WP_011346924.1.46449 WP_011346924.1.46677 WP_011346924.1.49886 WP_011346924.1.51091 WP_011346924.1.55770 WP_011346924.1.60785 WP_011346924.1.64411 WP_011346924.1.66420 WP_011346924.1.67180 WP_011346924.1.67877 WP_011346924.1.75734 WP_011346924.1.772 WP_011346924.1.79359 WP_011346924.1.81489 WP_011346924.1.8544 WP_011346924.1.89212 WP_011346924.1.89360 WP_011346924.1.94946 WP_011346924.1.99285 gi|78047074|ref|YP_363249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]