SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047148|ref|YP_363323.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047148|ref|YP_363323.1|
Domain Number 1 Region: 25-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.07e-48
Family Glutathione peroxidase-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78047148|ref|YP_363323.1|
Sequence length 185
Comment glutathione peroxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MLLNRLLALVLTGFFATSAFAAGTPVLDVEYRPLAGKTPINLNRTYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTQATGVAPGWNFHKYLISRDGRVVAQFPSKIKPDDPSVLAAIEREL
KAPAH
Download sequence
Identical sequences A0A0G8ZI52 A0A1S1XMJ5 G2LZ81 Q3BV90
gi|78047148|ref|YP_363323.1| gi|346724431|ref|YP_004851100.1| 316273.XCV1592 WP_011346979.1.100156 WP_011346979.1.100312 WP_011346979.1.10442 WP_011346979.1.11230 WP_011346979.1.12827 WP_011346979.1.13735 WP_011346979.1.14159 WP_011346979.1.16263 WP_011346979.1.17112 WP_011346979.1.19776 WP_011346979.1.199 WP_011346979.1.20169 WP_011346979.1.21303 WP_011346979.1.21317 WP_011346979.1.2230 WP_011346979.1.2259 WP_011346979.1.23534 WP_011346979.1.24172 WP_011346979.1.25231 WP_011346979.1.27112 WP_011346979.1.29361 WP_011346979.1.3003 WP_011346979.1.30677 WP_011346979.1.331 WP_011346979.1.3440 WP_011346979.1.37569 WP_011346979.1.37942 WP_011346979.1.39371 WP_011346979.1.40690 WP_011346979.1.43396 WP_011346979.1.43419 WP_011346979.1.44794 WP_011346979.1.46449 WP_011346979.1.46677 WP_011346979.1.47244 WP_011346979.1.47958 WP_011346979.1.48351 WP_011346979.1.49886 WP_011346979.1.50405 WP_011346979.1.51091 WP_011346979.1.5224 WP_011346979.1.54158 WP_011346979.1.54709 WP_011346979.1.55770 WP_011346979.1.56262 WP_011346979.1.57452 WP_011346979.1.59767 WP_011346979.1.60785 WP_011346979.1.61221 WP_011346979.1.64411 WP_011346979.1.656 WP_011346979.1.66420 WP_011346979.1.67180 WP_011346979.1.67877 WP_011346979.1.6838 WP_011346979.1.68402 WP_011346979.1.72305 WP_011346979.1.75734 WP_011346979.1.772 WP_011346979.1.77810 WP_011346979.1.78066 WP_011346979.1.79359 WP_011346979.1.79878 WP_011346979.1.80975 WP_011346979.1.81489 WP_011346979.1.85024 WP_011346979.1.85152 WP_011346979.1.8544 WP_011346979.1.86099 WP_011346979.1.89212 WP_011346979.1.89360 WP_011346979.1.94781 WP_011346979.1.94946 WP_011346979.1.96073 WP_011346979.1.9928 WP_011346979.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]