SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047267|ref|YP_363442.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047267|ref|YP_363442.1|
Domain Number 1 Region: 33-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.98e-33
Family Glutathione peroxidase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78047267|ref|YP_363442.1|
Sequence length 180
Comment thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MNRLLPLLGFVLLAALFGVGILRTMQHNPRDVPSPLIGKPAPAFSLPRLDHPAQRVGRDQ
LLGKPYVLNVFGSWCAECVHEHPVLMAQASRLGVPLIGYNYKDVPADAIAWLARLGNPYA
VVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLTPDAINDELLPAIAALPKGTP
Download sequence
Identical sequences A0A0G8ZLC4 A0A1S1XNE9 G2M1Q6 Q3BUX1
gi|78047267|ref|YP_363442.1| WP_008574944.1.100156 WP_008574944.1.100312 WP_008574944.1.10442 WP_008574944.1.11230 WP_008574944.1.12827 WP_008574944.1.13735 WP_008574944.1.14159 WP_008574944.1.16263 WP_008574944.1.17112 WP_008574944.1.19776 WP_008574944.1.199 WP_008574944.1.20169 WP_008574944.1.21303 WP_008574944.1.21317 WP_008574944.1.2230 WP_008574944.1.2259 WP_008574944.1.23534 WP_008574944.1.24172 WP_008574944.1.25231 WP_008574944.1.27112 WP_008574944.1.29361 WP_008574944.1.3003 WP_008574944.1.30677 WP_008574944.1.331 WP_008574944.1.3440 WP_008574944.1.37569 WP_008574944.1.37942 WP_008574944.1.39371 WP_008574944.1.40690 WP_008574944.1.43396 WP_008574944.1.43419 WP_008574944.1.44794 WP_008574944.1.46449 WP_008574944.1.46677 WP_008574944.1.47244 WP_008574944.1.47958 WP_008574944.1.49886 WP_008574944.1.50405 WP_008574944.1.5224 WP_008574944.1.54158 WP_008574944.1.54709 WP_008574944.1.55770 WP_008574944.1.56262 WP_008574944.1.57452 WP_008574944.1.59767 WP_008574944.1.60785 WP_008574944.1.61221 WP_008574944.1.64411 WP_008574944.1.656 WP_008574944.1.66420 WP_008574944.1.67180 WP_008574944.1.67877 WP_008574944.1.6838 WP_008574944.1.72305 WP_008574944.1.75734 WP_008574944.1.772 WP_008574944.1.78066 WP_008574944.1.79359 WP_008574944.1.79878 WP_008574944.1.80975 WP_008574944.1.81489 WP_008574944.1.85024 WP_008574944.1.85152 WP_008574944.1.8544 WP_008574944.1.86099 WP_008574944.1.89212 WP_008574944.1.89360 WP_008574944.1.94781 WP_008574944.1.94946 WP_008574944.1.96073 WP_008574944.1.9928 WP_008574944.1.99285 316273.XCV1711 gi|346724603|ref|YP_004851272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]