SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047862|ref|YP_364037.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047862|ref|YP_364037.1|
Domain Number 1 Region: 97-254
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-30
Family DsbC/DsbG C-terminal domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 31-87
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000549
Family DsbC/DsbG N-terminal domain-like 0.001
Further Details:      
 
Weak hits

Sequence:  gi|78047862|ref|YP_364037.1|
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0602
Family Outer membrane efflux proteins (OEP) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78047862|ref|YP_364037.1|
Sequence length 257
Comment disulfide isomerase/thiol-disulfide oxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MFAKRSRISLFLAASLLLVTGCSQAETANQPPALKALEDQGLTVMQEFKVGGGLRAFAAV
AGDRPVAIYITSDGNAIVGTRLNAKGEPIDEAALNNLAAKPLSDKEWAQLQSATSVRDGQ
ANAPRIVYAFSDANCPYCHRFWEAARPWVDAGKVQIRHIMVGIIREDSPAKAAAILGAAD
PSAALLENERKYSQGGITPAKSIPANVRKTLDDNQMLMLSMGFRGTPGIVVRGPDGVLKK
YNGMPQGPQLAEVLGPR
Download sequence
Identical sequences A1W5P7 Q3BT76
WP_011347503.1.100156 WP_011347503.1.10851 WP_011347503.1.1166 WP_011347503.1.15547 WP_011347503.1.22175 WP_011347503.1.22218 WP_011347503.1.25034 WP_011347503.1.32398 WP_011347503.1.36423 WP_011347503.1.39107 WP_011347503.1.39276 WP_011347503.1.46677 WP_011347503.1.46794 WP_011347503.1.48997 WP_011347503.1.50840 WP_011347503.1.51974 WP_011347503.1.55042 WP_011347503.1.57447 WP_011347503.1.5773 WP_011347503.1.59344 WP_011347503.1.59475 WP_011347503.1.63472 WP_011347503.1.68100 WP_011347503.1.71282 WP_011347503.1.75714 WP_011347503.1.75887 WP_011347503.1.77749 WP_011347503.1.78085 WP_011347503.1.78834 WP_011347503.1.79438 WP_011347503.1.83765 WP_011347503.1.85154 WP_011347503.1.85744 WP_011347503.1.86513 WP_011347503.1.87490 WP_011347503.1.88184 WP_011347503.1.88381 WP_011347503.1.88916 WP_011347503.1.89316 WP_011347503.1.90836 WP_011347503.1.90933 WP_011347503.1.91074 WP_011347503.1.92898 WP_011347503.1.92934 WP_011347503.1.98528 gi|78047862|ref|YP_364037.1| gi|121593752|ref|YP_985648.1| 232721.Ajs_1355 316273.XCV2306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]