SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047869|ref|YP_364044.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047869|ref|YP_364044.1|
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.79e-35
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78047869|ref|YP_364044.1|
Sequence length 106
Comment thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MLQELNNDNFDTTLGQVPGVYAVRFWAEWCGPCRVMSPIFKDVARDMQDRAHFGEVDIDQ
APELAGRFGVQSIPTVVLFKDGQVIDRMTGAAPKPNVLRFINNHLD
Download sequence
Identical sequences A1W5Q4 Q3BT69
gi|121593759|ref|YP_985655.1| 232721.Ajs_1362 316273.XCV2313 WP_011347510.1.100156 WP_011347510.1.10851 WP_011347510.1.1166 WP_011347510.1.15547 WP_011347510.1.22175 WP_011347510.1.22218 WP_011347510.1.25034 WP_011347510.1.32398 WP_011347510.1.36423 WP_011347510.1.39107 WP_011347510.1.39276 WP_011347510.1.46677 WP_011347510.1.46794 WP_011347510.1.48997 WP_011347510.1.50840 WP_011347510.1.51974 WP_011347510.1.55042 WP_011347510.1.57447 WP_011347510.1.5773 WP_011347510.1.59344 WP_011347510.1.59475 WP_011347510.1.63472 WP_011347510.1.68100 WP_011347510.1.71282 WP_011347510.1.75714 WP_011347510.1.75887 WP_011347510.1.77749 WP_011347510.1.78085 WP_011347510.1.78834 WP_011347510.1.79438 WP_011347510.1.83765 WP_011347510.1.85154 WP_011347510.1.85744 WP_011347510.1.86513 WP_011347510.1.87490 WP_011347510.1.88184 WP_011347510.1.88381 WP_011347510.1.88916 WP_011347510.1.89212 WP_011347510.1.89316 WP_011347510.1.90836 WP_011347510.1.90933 WP_011347510.1.91074 WP_011347510.1.92898 WP_011347510.1.92934 WP_011347510.1.98528 gi|78047869|ref|YP_364044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]