SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047920|ref|YP_364095.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|78047920|ref|YP_364095.1|
Domain Number - Region: 103-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0082
Family DsbA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78047920|ref|YP_364095.1|
Sequence length 148
Comment hypothetical protein XCV2364 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MPASLSRFAPGWRTLGLAVALPAALAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDE
AHRIEAELSAGLSADSEQATVIVRRRLSSGGADLQRHIASAYQGVTDAWSLGITGIPAVV
VDQRYVVYGEPDVARAVARIEQYRRNQP
Download sequence
Identical sequences Q3BT18
gi|78047920|ref|YP_364095.1| WP_011347551.1.100156 WP_011347551.1.10851 WP_011347551.1.1166 WP_011347551.1.15547 WP_011347551.1.22175 WP_011347551.1.22218 WP_011347551.1.25034 WP_011347551.1.32398 WP_011347551.1.36423 WP_011347551.1.39276 WP_011347551.1.46677 WP_011347551.1.46794 WP_011347551.1.48997 WP_011347551.1.50840 WP_011347551.1.51974 WP_011347551.1.55042 WP_011347551.1.57447 WP_011347551.1.5773 WP_011347551.1.59344 WP_011347551.1.59475 WP_011347551.1.63472 WP_011347551.1.68100 WP_011347551.1.71282 WP_011347551.1.75714 WP_011347551.1.75887 WP_011347551.1.77749 WP_011347551.1.78085 WP_011347551.1.78834 WP_011347551.1.79438 WP_011347551.1.83765 WP_011347551.1.85154 WP_011347551.1.85744 WP_011347551.1.86513 WP_011347551.1.87490 WP_011347551.1.88184 WP_011347551.1.88381 WP_011347551.1.88916 WP_011347551.1.89212 WP_011347551.1.89316 WP_011347551.1.90836 WP_011347551.1.90933 WP_011347551.1.91074 WP_011347551.1.92898 WP_011347551.1.92934 WP_011347551.1.98528 316273.XCV2364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]