SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047936|ref|YP_364111.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|78047936|ref|YP_364111.1|
Domain Number - Region: 146-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0127
Family Thioltransferase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78047936|ref|YP_364111.1|
Sequence length 241
Comment hypothetical protein XCV2380 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKPSIILSAFLLASAQWPAWAQQPTSAPARNAQSQERPLATRALDDRVASDWGLQPQEWA
RYRELMDGPLGIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLPDDKPAAGATRGSGRTAVFVKDGCAACDQLVQRLQSAGTEFDLYMV
GSRQDDGRIRDWAKRANVDPARVRGGTITLNHDGGRWLSLGLPGDLPAVVREVNGQWQRQ
P
Download sequence
Identical sequences Q3BT02
316273.XCV2380 gi|78047936|ref|YP_364111.1| WP_011347567.1.100156 WP_011347567.1.46677 WP_011347567.1.89212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]