SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048187|ref|YP_364362.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048187|ref|YP_364362.1|
Domain Number 1 Region: 82-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.56e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0099
Further Details:      
 
Domain Number 2 Region: 10-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.12e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78048187|ref|YP_364362.1|
Sequence length 211
Comment stringent starvation protein A [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPEDLIDLNPYHSVP
TLVERDLVLYAASVVSEYLDERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLG
NKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCAMAPIIWRLDALEISLPKDGK
AIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG
Download sequence
Identical sequences A0A0A6W9L4 A0A0G9C819 A0A0U5BTW5 A0A1D9EI43 A0A1S1XQZ0 A0A1T1NP81 A0A1T1R783 A0A1T1S295 A0A1U8Z7Z1 A0A220WH11 A0A221MQ07 A0A2D2U6Y1 D4SVH7 D4T812 G2LVX5 M4TX66 Q3BSA1 Q8PJS6 U4M0W2
gi|346725322|ref|YP_004851991.1| WP_005915265.1.100156 WP_005915265.1.100312 WP_005915265.1.100431 WP_005915265.1.101491 WP_005915265.1.101581 WP_005915265.1.101846 WP_005915265.1.12827 WP_005915265.1.13318 WP_005915265.1.13350 WP_005915265.1.13735 WP_005915265.1.14032 WP_005915265.1.14159 WP_005915265.1.14945 WP_005915265.1.15350 WP_005915265.1.15678 WP_005915265.1.16263 WP_005915265.1.16332 WP_005915265.1.17112 WP_005915265.1.18336 WP_005915265.1.19505 WP_005915265.1.19776 WP_005915265.1.199 WP_005915265.1.20169 WP_005915265.1.21004 WP_005915265.1.21317 WP_005915265.1.21440 WP_005915265.1.22109 WP_005915265.1.22114 WP_005915265.1.2230 WP_005915265.1.22678 WP_005915265.1.23375 WP_005915265.1.23534 WP_005915265.1.24172 WP_005915265.1.2491 WP_005915265.1.25231 WP_005915265.1.25999 WP_005915265.1.26095 WP_005915265.1.27112 WP_005915265.1.28779 WP_005915265.1.29361 WP_005915265.1.29860 WP_005915265.1.30380 WP_005915265.1.30571 WP_005915265.1.30677 WP_005915265.1.30778 WP_005915265.1.31364 WP_005915265.1.31392 WP_005915265.1.3308 WP_005915265.1.331 WP_005915265.1.34035 WP_005915265.1.34103 WP_005915265.1.3440 WP_005915265.1.35540 WP_005915265.1.35849 WP_005915265.1.3651 WP_005915265.1.3710 WP_005915265.1.37228 WP_005915265.1.37259 WP_005915265.1.37569 WP_005915265.1.38217 WP_005915265.1.39341 WP_005915265.1.39371 WP_005915265.1.39696 WP_005915265.1.40308 WP_005915265.1.40689 WP_005915265.1.40690 WP_005915265.1.41216 WP_005915265.1.41431 WP_005915265.1.42602 WP_005915265.1.42745 WP_005915265.1.43379 WP_005915265.1.43419 WP_005915265.1.43567 WP_005915265.1.43799 WP_005915265.1.43832 WP_005915265.1.4389 WP_005915265.1.45197 WP_005915265.1.46272 WP_005915265.1.46449 WP_005915265.1.46464 WP_005915265.1.46677 WP_005915265.1.47244 WP_005915265.1.47697 WP_005915265.1.47707 WP_005915265.1.47958 WP_005915265.1.48351 WP_005915265.1.49137 WP_005915265.1.50405 WP_005915265.1.51091 WP_005915265.1.52218 WP_005915265.1.5224 WP_005915265.1.52489 WP_005915265.1.53417 WP_005915265.1.53650 WP_005915265.1.54158 WP_005915265.1.54709 WP_005915265.1.55770 WP_005915265.1.55935 WP_005915265.1.56030 WP_005915265.1.56075 WP_005915265.1.56262 WP_005915265.1.56360 WP_005915265.1.56391 WP_005915265.1.56804 WP_005915265.1.57452 WP_005915265.1.57989 WP_005915265.1.58141 WP_005915265.1.58382 WP_005915265.1.59630 WP_005915265.1.59767 WP_005915265.1.60328 WP_005915265.1.60785 WP_005915265.1.61221 WP_005915265.1.61945 WP_005915265.1.61999 WP_005915265.1.62152 WP_005915265.1.62531 WP_005915265.1.6260 WP_005915265.1.63386 WP_005915265.1.64411 WP_005915265.1.64541 WP_005915265.1.656 WP_005915265.1.66420 WP_005915265.1.67180 WP_005915265.1.6771 WP_005915265.1.67877 WP_005915265.1.67913 WP_005915265.1.6829 WP_005915265.1.6838 WP_005915265.1.70026 WP_005915265.1.70193 WP_005915265.1.71126 WP_005915265.1.71284 WP_005915265.1.71353 WP_005915265.1.72305 WP_005915265.1.72777 WP_005915265.1.72810 WP_005915265.1.74121 WP_005915265.1.74178 WP_005915265.1.7523 WP_005915265.1.75734 WP_005915265.1.76206 WP_005915265.1.76535 WP_005915265.1.772 WP_005915265.1.77810 WP_005915265.1.78066 WP_005915265.1.79813 WP_005915265.1.79878 WP_005915265.1.79879 WP_005915265.1.80421 WP_005915265.1.80602 WP_005915265.1.80975 WP_005915265.1.81086 WP_005915265.1.81489 WP_005915265.1.81510 WP_005915265.1.81579 WP_005915265.1.81711 WP_005915265.1.82045 WP_005915265.1.82073 WP_005915265.1.82115 WP_005915265.1.85024 WP_005915265.1.85152 WP_005915265.1.8544 WP_005915265.1.85778 WP_005915265.1.86099 WP_005915265.1.86317 WP_005915265.1.87207 WP_005915265.1.87455 WP_005915265.1.88516 WP_005915265.1.88706 WP_005915265.1.88988 WP_005915265.1.89206 WP_005915265.1.89212 WP_005915265.1.89360 WP_005915265.1.90138 WP_005915265.1.90200 WP_005915265.1.90226 WP_005915265.1.90594 WP_005915265.1.91667 WP_005915265.1.92002 WP_005915265.1.92041 WP_005915265.1.92912 WP_005915265.1.93402 WP_005915265.1.93813 WP_005915265.1.94705 WP_005915265.1.94781 WP_005915265.1.96073 WP_005915265.1.96706 WP_005915265.1.96800 WP_005915265.1.97098 WP_005915265.1.97233 WP_005915265.1.98824 WP_005915265.1.9928 WP_005915265.1.99285 WP_005915265.1.99816 WP_005915265.1.99907 190486.XAC2454 316273.XCV2631 gi|471267648|ref|YP_007650113.1| gi|78048187|ref|YP_364362.1| gi|470472332|ref|YP_007636900.1| gi|21243187|ref|NP_642769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]