SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048382|ref|YP_364557.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048382|ref|YP_364557.1|
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.05e-30
Family Thioltransferase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78048382|ref|YP_364557.1|
Sequence length 106
Comment glutaredoxin-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MPVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTVNVLEEPEVRA
NLPRYSNWPTFPQLFIHGELIGGCDITLELFEAGELKRIVSEAYQP
Download sequence
Identical sequences A0A0A6TJJ1 A0A0G9CQU6 A0A0N8GDR2 A0A0N8TPC6 A0A0U5FF18 A0A0W7XP43 A0A1D9EHT6 A0A1T1P6J6 A0A1T1R419 A0A1T1SIK8 A0A1U8YUH0 A0A220WG39 A0A221LZV1 A0A2D2UE86 A0A2K2R804 D4SRZ6 D4T4H4 G2LXH9 H8FEW2 M4TVN4 Q3BRQ6 Q8PJ66
gi|470472554|ref|YP_007637122.1| WP_003485599.1.100156 WP_003485599.1.100312 WP_003485599.1.100431 WP_003485599.1.101581 WP_003485599.1.101846 WP_003485599.1.101985 WP_003485599.1.102013 WP_003485599.1.10442 WP_003485599.1.11230 WP_003485599.1.12064 WP_003485599.1.12457 WP_003485599.1.1263 WP_003485599.1.12827 WP_003485599.1.13318 WP_003485599.1.13350 WP_003485599.1.13735 WP_003485599.1.14032 WP_003485599.1.14159 WP_003485599.1.14165 WP_003485599.1.14945 WP_003485599.1.15350 WP_003485599.1.15539 WP_003485599.1.15678 WP_003485599.1.16332 WP_003485599.1.17112 WP_003485599.1.17148 WP_003485599.1.17215 WP_003485599.1.18336 WP_003485599.1.19065 WP_003485599.1.19305 WP_003485599.1.19505 WP_003485599.1.19776 WP_003485599.1.199 WP_003485599.1.20043 WP_003485599.1.2014 WP_003485599.1.20169 WP_003485599.1.21004 WP_003485599.1.21227 WP_003485599.1.21303 WP_003485599.1.21317 WP_003485599.1.21440 WP_003485599.1.22109 WP_003485599.1.22114 WP_003485599.1.2230 WP_003485599.1.2259 WP_003485599.1.22678 WP_003485599.1.22888 WP_003485599.1.23342 WP_003485599.1.23375 WP_003485599.1.23534 WP_003485599.1.24172 WP_003485599.1.24624 WP_003485599.1.2476 WP_003485599.1.2491 WP_003485599.1.25231 WP_003485599.1.25999 WP_003485599.1.26095 WP_003485599.1.27112 WP_003485599.1.28321 WP_003485599.1.28779 WP_003485599.1.29361 WP_003485599.1.29860 WP_003485599.1.3003 WP_003485599.1.30380 WP_003485599.1.30571 WP_003485599.1.30677 WP_003485599.1.30778 WP_003485599.1.31364 WP_003485599.1.31392 WP_003485599.1.32205 WP_003485599.1.3308 WP_003485599.1.331 WP_003485599.1.34035 WP_003485599.1.34103 WP_003485599.1.3440 WP_003485599.1.35047 WP_003485599.1.35540 WP_003485599.1.35849 WP_003485599.1.3651 WP_003485599.1.3654 WP_003485599.1.3710 WP_003485599.1.37228 WP_003485599.1.37257 WP_003485599.1.37259 WP_003485599.1.37569 WP_003485599.1.37942 WP_003485599.1.38016 WP_003485599.1.38217 WP_003485599.1.39341 WP_003485599.1.39371 WP_003485599.1.39696 WP_003485599.1.40308 WP_003485599.1.40690 WP_003485599.1.41197 WP_003485599.1.41216 WP_003485599.1.41431 WP_003485599.1.42335 WP_003485599.1.42602 WP_003485599.1.42745 WP_003485599.1.43396 WP_003485599.1.43419 WP_003485599.1.43567 WP_003485599.1.43799 WP_003485599.1.43832 WP_003485599.1.4389 WP_003485599.1.44297 WP_003485599.1.44794 WP_003485599.1.45126 WP_003485599.1.45197 WP_003485599.1.46272 WP_003485599.1.46449 WP_003485599.1.46464 WP_003485599.1.46677 WP_003485599.1.47244 WP_003485599.1.47501 WP_003485599.1.47697 WP_003485599.1.47707 WP_003485599.1.47931 WP_003485599.1.47958 WP_003485599.1.48351 WP_003485599.1.49137 WP_003485599.1.49886 WP_003485599.1.51018 WP_003485599.1.51091 WP_003485599.1.52184 WP_003485599.1.52218 WP_003485599.1.5224 WP_003485599.1.52489 WP_003485599.1.52767 WP_003485599.1.53417 WP_003485599.1.5365 WP_003485599.1.53650 WP_003485599.1.54158 WP_003485599.1.54200 WP_003485599.1.54709 WP_003485599.1.55132 WP_003485599.1.55770 WP_003485599.1.55809 WP_003485599.1.55935 WP_003485599.1.56030 WP_003485599.1.56075 WP_003485599.1.56262 WP_003485599.1.56360 WP_003485599.1.56391 WP_003485599.1.56804 WP_003485599.1.57452 WP_003485599.1.58141 WP_003485599.1.58382 WP_003485599.1.58982 WP_003485599.1.59630 WP_003485599.1.59767 WP_003485599.1.6015 WP_003485599.1.60406 WP_003485599.1.60785 WP_003485599.1.61221 WP_003485599.1.61498 WP_003485599.1.61945 WP_003485599.1.61999 WP_003485599.1.62531 WP_003485599.1.6260 WP_003485599.1.63386 WP_003485599.1.64411 WP_003485599.1.64541 WP_003485599.1.65037 WP_003485599.1.65450 WP_003485599.1.656 WP_003485599.1.66420 WP_003485599.1.67180 WP_003485599.1.6771 WP_003485599.1.67877 WP_003485599.1.67913 WP_003485599.1.6829 WP_003485599.1.6838 WP_003485599.1.68383 WP_003485599.1.68402 WP_003485599.1.70026 WP_003485599.1.70193 WP_003485599.1.70738 WP_003485599.1.71126 WP_003485599.1.71284 WP_003485599.1.71353 WP_003485599.1.71699 WP_003485599.1.72092 WP_003485599.1.72305 WP_003485599.1.72777 WP_003485599.1.72810 WP_003485599.1.73738 WP_003485599.1.74035 WP_003485599.1.74121 WP_003485599.1.74178 WP_003485599.1.74279 WP_003485599.1.7523 WP_003485599.1.75313 WP_003485599.1.75734 WP_003485599.1.76206 WP_003485599.1.76535 WP_003485599.1.7704 WP_003485599.1.772 WP_003485599.1.77810 WP_003485599.1.78066 WP_003485599.1.78220 WP_003485599.1.78473 WP_003485599.1.79359 WP_003485599.1.79366 WP_003485599.1.79813 WP_003485599.1.79878 WP_003485599.1.79879 WP_003485599.1.79906 WP_003485599.1.80421 WP_003485599.1.80602 WP_003485599.1.80975 WP_003485599.1.81086 WP_003485599.1.81486 WP_003485599.1.81489 WP_003485599.1.81510 WP_003485599.1.81579 WP_003485599.1.81711 WP_003485599.1.82045 WP_003485599.1.82073 WP_003485599.1.82115 WP_003485599.1.83358 WP_003485599.1.83628 WP_003485599.1.85024 WP_003485599.1.85152 WP_003485599.1.8544 WP_003485599.1.85778 WP_003485599.1.86099 WP_003485599.1.86317 WP_003485599.1.8651 WP_003485599.1.87207 WP_003485599.1.87349 WP_003485599.1.87455 WP_003485599.1.88516 WP_003485599.1.88706 WP_003485599.1.88740 WP_003485599.1.88988 WP_003485599.1.89206 WP_003485599.1.89212 WP_003485599.1.89360 WP_003485599.1.89772 WP_003485599.1.90138 WP_003485599.1.90200 WP_003485599.1.90226 WP_003485599.1.90230 WP_003485599.1.90594 WP_003485599.1.91667 WP_003485599.1.92002 WP_003485599.1.92041 WP_003485599.1.92912 WP_003485599.1.9340 WP_003485599.1.93402 WP_003485599.1.93813 WP_003485599.1.94147 WP_003485599.1.94705 WP_003485599.1.94781 WP_003485599.1.94946 WP_003485599.1.95108 WP_003485599.1.96073 WP_003485599.1.96108 WP_003485599.1.96329 WP_003485599.1.96706 WP_003485599.1.96800 WP_003485599.1.97098 WP_003485599.1.97233 WP_003485599.1.97426 WP_003485599.1.98344 WP_003485599.1.98824 WP_003485599.1.9928 WP_003485599.1.99285 WP_003485599.1.99816 gi|346725500|ref|YP_004852169.1| gi|21243405|ref|NP_642987.1| gi|471267034|ref|YP_007649499.1| 190486.XAC2676 316273.XCV2826 gi|78048382|ref|YP_364557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]