SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048405|ref|YP_364580.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048405|ref|YP_364580.1|
Domain Number 1 Region: 20-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-46
Family NQO2-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78048405|ref|YP_364580.1|
Sequence length 175
Comment NADH dehydrogenase subunit E [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKATGNFEAARDVDPQVVLSDKTRAHIDHWLTKFPPDRKRSAVLQGLHAAQEQNQGWLTD
ELIVGVAKYLELPPVWAYEVASFYSMFETERVGRHNVAFCTNISCWLNGAEDLLAHAEKK
LGCKLGQSTADGRVYLKREEECLAACSAAPMMVINGHYHEHLTKEKVDALLDGLE
Download sequence
Identical sequences A0A098PXN3 A0A099Q7U4 A0A0A6W5S9 A0A0G8TYD3 A0A0P6VHM9 A0A0U5BVJ5 A0A0W7XP32 A0A1D9EHF6 A0A1S1XHM6 A0A1T1P6E1 A0A1T1R3Z6 A0A1T1SIB1 A0A1V9H1W5 A0A2K2R849 G2LXK2 H8FET9 M4TVZ5 Q3BRN3 Q8PJ44
gi|470472580|ref|YP_007637148.1| gi|21243428|ref|NP_643010.1| 190486.XAC2700 316273.XCV2849 gi|78048405|ref|YP_364580.1| gi|346725523|ref|YP_004852192.1| WP_003485548.1.100156 WP_003485548.1.100312 WP_003485548.1.101491 WP_003485548.1.101581 WP_003485548.1.101846 WP_003485548.1.101985 WP_003485548.1.102013 WP_003485548.1.10442 WP_003485548.1.11230 WP_003485548.1.12064 WP_003485548.1.12457 WP_003485548.1.1263 WP_003485548.1.12827 WP_003485548.1.13318 WP_003485548.1.13350 WP_003485548.1.13735 WP_003485548.1.14032 WP_003485548.1.14159 WP_003485548.1.14165 WP_003485548.1.14945 WP_003485548.1.15350 WP_003485548.1.15539 WP_003485548.1.15678 WP_003485548.1.15826 WP_003485548.1.16263 WP_003485548.1.16332 WP_003485548.1.17112 WP_003485548.1.17215 WP_003485548.1.18336 WP_003485548.1.19065 WP_003485548.1.19305 WP_003485548.1.19505 WP_003485548.1.19776 WP_003485548.1.199 WP_003485548.1.20043 WP_003485548.1.2014 WP_003485548.1.20169 WP_003485548.1.21004 WP_003485548.1.21227 WP_003485548.1.21303 WP_003485548.1.21317 WP_003485548.1.21440 WP_003485548.1.22109 WP_003485548.1.2230 WP_003485548.1.2259 WP_003485548.1.22678 WP_003485548.1.22888 WP_003485548.1.23342 WP_003485548.1.23375 WP_003485548.1.23534 WP_003485548.1.24172 WP_003485548.1.24624 WP_003485548.1.2476 WP_003485548.1.25231 WP_003485548.1.25999 WP_003485548.1.26095 WP_003485548.1.27112 WP_003485548.1.28321 WP_003485548.1.28535 WP_003485548.1.28779 WP_003485548.1.29361 WP_003485548.1.29860 WP_003485548.1.3003 WP_003485548.1.30380 WP_003485548.1.30677 WP_003485548.1.30778 WP_003485548.1.31364 WP_003485548.1.31392 WP_003485548.1.32205 WP_003485548.1.3308 WP_003485548.1.331 WP_003485548.1.34035 WP_003485548.1.3440 WP_003485548.1.35047 WP_003485548.1.35540 WP_003485548.1.3651 WP_003485548.1.3654 WP_003485548.1.37228 WP_003485548.1.37257 WP_003485548.1.37569 WP_003485548.1.37942 WP_003485548.1.38016 WP_003485548.1.38217 WP_003485548.1.39341 WP_003485548.1.39371 WP_003485548.1.39696 WP_003485548.1.40690 WP_003485548.1.41197 WP_003485548.1.41216 WP_003485548.1.41431 WP_003485548.1.42335 WP_003485548.1.42745 WP_003485548.1.43396 WP_003485548.1.43419 WP_003485548.1.43567 WP_003485548.1.43799 WP_003485548.1.43832 WP_003485548.1.4389 WP_003485548.1.44297 WP_003485548.1.44794 WP_003485548.1.45126 WP_003485548.1.46272 WP_003485548.1.46449 WP_003485548.1.46464 WP_003485548.1.46677 WP_003485548.1.47244 WP_003485548.1.47501 WP_003485548.1.47697 WP_003485548.1.47707 WP_003485548.1.47931 WP_003485548.1.47958 WP_003485548.1.48351 WP_003485548.1.49137 WP_003485548.1.49886 WP_003485548.1.50405 WP_003485548.1.51018 WP_003485548.1.52184 WP_003485548.1.52218 WP_003485548.1.5224 WP_003485548.1.52767 WP_003485548.1.53417 WP_003485548.1.5365 WP_003485548.1.54158 WP_003485548.1.54200 WP_003485548.1.54709 WP_003485548.1.55770 WP_003485548.1.55809 WP_003485548.1.55935 WP_003485548.1.56030 WP_003485548.1.56075 WP_003485548.1.56262 WP_003485548.1.56360 WP_003485548.1.56391 WP_003485548.1.56804 WP_003485548.1.57452 WP_003485548.1.58141 WP_003485548.1.58382 WP_003485548.1.58982 WP_003485548.1.59630 WP_003485548.1.59767 WP_003485548.1.6015 WP_003485548.1.60328 WP_003485548.1.60406 WP_003485548.1.60785 WP_003485548.1.61221 WP_003485548.1.61498 WP_003485548.1.61945 WP_003485548.1.61999 WP_003485548.1.62531 WP_003485548.1.6260 WP_003485548.1.63386 WP_003485548.1.64411 WP_003485548.1.65037 WP_003485548.1.65450 WP_003485548.1.656 WP_003485548.1.66420 WP_003485548.1.67180 WP_003485548.1.67877 WP_003485548.1.67913 WP_003485548.1.6829 WP_003485548.1.6838 WP_003485548.1.68383 WP_003485548.1.68402 WP_003485548.1.70026 WP_003485548.1.70193 WP_003485548.1.70738 WP_003485548.1.71126 WP_003485548.1.71284 WP_003485548.1.71699 WP_003485548.1.72305 WP_003485548.1.72777 WP_003485548.1.72810 WP_003485548.1.73738 WP_003485548.1.74035 WP_003485548.1.74178 WP_003485548.1.74279 WP_003485548.1.7523 WP_003485548.1.75313 WP_003485548.1.75734 WP_003485548.1.76206 WP_003485548.1.7704 WP_003485548.1.772 WP_003485548.1.77810 WP_003485548.1.78066 WP_003485548.1.78220 WP_003485548.1.78473 WP_003485548.1.79359 WP_003485548.1.79366 WP_003485548.1.79813 WP_003485548.1.79878 WP_003485548.1.79879 WP_003485548.1.79906 WP_003485548.1.80421 WP_003485548.1.80602 WP_003485548.1.80975 WP_003485548.1.81086 WP_003485548.1.81486 WP_003485548.1.81489 WP_003485548.1.81510 WP_003485548.1.81579 WP_003485548.1.81711 WP_003485548.1.82073 WP_003485548.1.82115 WP_003485548.1.83358 WP_003485548.1.85024 WP_003485548.1.85152 WP_003485548.1.8544 WP_003485548.1.86099 WP_003485548.1.8651 WP_003485548.1.87349 WP_003485548.1.87455 WP_003485548.1.88516 WP_003485548.1.88706 WP_003485548.1.88740 WP_003485548.1.88988 WP_003485548.1.89206 WP_003485548.1.89212 WP_003485548.1.89360 WP_003485548.1.89772 WP_003485548.1.90138 WP_003485548.1.90200 WP_003485548.1.90226 WP_003485548.1.90230 WP_003485548.1.90594 WP_003485548.1.92002 WP_003485548.1.92041 WP_003485548.1.92912 WP_003485548.1.9340 WP_003485548.1.93813 WP_003485548.1.94147 WP_003485548.1.94705 WP_003485548.1.94781 WP_003485548.1.94946 WP_003485548.1.95108 WP_003485548.1.96073 WP_003485548.1.96108 WP_003485548.1.96329 WP_003485548.1.96706 WP_003485548.1.97098 WP_003485548.1.97426 WP_003485548.1.98344 WP_003485548.1.9928 WP_003485548.1.99285 WP_003485548.1.99816 WP_003485548.1.99907 gi|471267011|ref|YP_007649476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]