SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048435|ref|YP_364610.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048435|ref|YP_364610.1|
Domain Number 1 Region: 47-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-40
Family Glutathione peroxidase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78048435|ref|YP_364610.1|
Sequence length 216
Comment SCO1/SenC family protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MFNRNTGIVLLVALAAGLGMLLGQKFLGGAPSSPWPPTKTITFYPQPRPLPQFSLRQSDG
TQLVPGELKGHWTLVFLGFTFCPDVCPTTLTDLAVAQQQWESIPDGLRPRVLFVSVDPQR
DPPARLGEYAHAFHKDTLAATADVPALERFATALGFVFQKVPGKGYAQNPNDYSMDHSAG
IAVLDPQGRLAGLIRPPLDPKAIAADLQQLTKVTAP
Download sequence
Identical sequences A0A0A6TL51 A0A0G9A2W7 A0A0Q0GZ32 A0A1S1XNR7 A0A1V9H1P7 A0A221MQQ8 Q3BRK3
316273.XCV2879 WP_008577518.1.100156 WP_008577518.1.100312 WP_008577518.1.10442 WP_008577518.1.11230 WP_008577518.1.12827 WP_008577518.1.13735 WP_008577518.1.14032 WP_008577518.1.14159 WP_008577518.1.16263 WP_008577518.1.17112 WP_008577518.1.19776 WP_008577518.1.199 WP_008577518.1.20169 WP_008577518.1.21303 WP_008577518.1.21317 WP_008577518.1.2259 WP_008577518.1.23534 WP_008577518.1.24172 WP_008577518.1.2491 WP_008577518.1.25231 WP_008577518.1.25999 WP_008577518.1.27112 WP_008577518.1.29361 WP_008577518.1.3003 WP_008577518.1.30571 WP_008577518.1.30677 WP_008577518.1.31364 WP_008577518.1.331 WP_008577518.1.34035 WP_008577518.1.3440 WP_008577518.1.37569 WP_008577518.1.37942 WP_008577518.1.39371 WP_008577518.1.40690 WP_008577518.1.43396 WP_008577518.1.43419 WP_008577518.1.43567 WP_008577518.1.44794 WP_008577518.1.46449 WP_008577518.1.46677 WP_008577518.1.47244 WP_008577518.1.47958 WP_008577518.1.48351 WP_008577518.1.49137 WP_008577518.1.49886 WP_008577518.1.50405 WP_008577518.1.51091 WP_008577518.1.52218 WP_008577518.1.5224 WP_008577518.1.54158 WP_008577518.1.54709 WP_008577518.1.55132 WP_008577518.1.55770 WP_008577518.1.56262 WP_008577518.1.56360 WP_008577518.1.57452 WP_008577518.1.59767 WP_008577518.1.60785 WP_008577518.1.61221 WP_008577518.1.64411 WP_008577518.1.656 WP_008577518.1.66420 WP_008577518.1.67180 WP_008577518.1.67877 WP_008577518.1.6838 WP_008577518.1.68402 WP_008577518.1.72092 WP_008577518.1.72305 WP_008577518.1.72777 WP_008577518.1.75734 WP_008577518.1.76535 WP_008577518.1.772 WP_008577518.1.77810 WP_008577518.1.78066 WP_008577518.1.79359 WP_008577518.1.79878 WP_008577518.1.80975 WP_008577518.1.81489 WP_008577518.1.83628 WP_008577518.1.85024 WP_008577518.1.85152 WP_008577518.1.8544 WP_008577518.1.85778 WP_008577518.1.86099 WP_008577518.1.89212 WP_008577518.1.89360 WP_008577518.1.94781 WP_008577518.1.94946 WP_008577518.1.96073 WP_008577518.1.9928 WP_008577518.1.99285 gi|78048435|ref|YP_364610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]