SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048883|ref|YP_365058.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048883|ref|YP_365058.1|
Domain Number 1 Region: 104-227
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.81e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000186
Family Glutathione S-transferase (GST), N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78048883|ref|YP_365058.1|
Sequence length 235
Comment glutathione S-transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MHYQLYYWTGLQGRGEFVRLALEDAGAAYTDVARIQGDEVMTAFLQGEQVGAQPFAPPFL
KAGDVVVAQVAAILHFIGPQLQLVPDSEPQRLQALQLQLTIADLVAEVHDTHHPIATGLY
YEDQQAEAAKRAQDLRENRLPKFLGYFEQVLQQAGGTHVLGTHSYLDLSLFQLFSGLEYM
FPKRMARLAKNLPGLKALQRHVAQRPRVAAYLASERRVAFNTNGIFRHYPELDAA
Download sequence
Identical sequences Q3BQA5
gi|78048883|ref|YP_365058.1| WP_011348318.1.100156 WP_011348318.1.10442 WP_011348318.1.11230 WP_011348318.1.13735 WP_011348318.1.199 WP_011348318.1.21303 WP_011348318.1.21317 WP_011348318.1.2259 WP_011348318.1.23534 WP_011348318.1.27112 WP_011348318.1.29361 WP_011348318.1.3003 WP_011348318.1.37942 WP_011348318.1.39371 WP_011348318.1.40690 WP_011348318.1.43396 WP_011348318.1.44794 WP_011348318.1.46449 WP_011348318.1.46677 WP_011348318.1.49886 WP_011348318.1.55770 WP_011348318.1.60785 WP_011348318.1.64411 WP_011348318.1.66420 WP_011348318.1.67180 WP_011348318.1.75734 WP_011348318.1.772 WP_011348318.1.79359 WP_011348318.1.81489 WP_011348318.1.89212 WP_011348318.1.89360 WP_011348318.1.94946 WP_011348318.1.99285 316273.XCV3327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]