SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78049287|ref|YP_365462.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049287|ref|YP_365462.1|
Domain Number 1 Region: 88-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.41e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78049287|ref|YP_365462.1|
Sequence length 220
Comment maleylacetoacetate isomerase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSAALELFSYWRSSAAYRVRIGLGLKVLDYIARPVHLVRDGGEQHAPAYAQLNPQELVPT
LRHGDVVITQSLAILEYLEEAFARTTALLPRAPAERARVRALAQLIACDVHPLNNLRVMQ
VLEREFALEGAQRQQWTRHWMERGFAALETQLARDAQTGCFCHGDAPGLADCVLIPQLYN
AHRFEVDLAPYPTLRRIEQACLQLPAFDAARPEMQADAVG
Download sequence
Identical sequences Q3BP51
WP_011348630.1.100156 WP_011348630.1.10442 WP_011348630.1.11230 WP_011348630.1.13735 WP_011348630.1.199 WP_011348630.1.21303 WP_011348630.1.21317 WP_011348630.1.2259 WP_011348630.1.23534 WP_011348630.1.27112 WP_011348630.1.29361 WP_011348630.1.3003 WP_011348630.1.37942 WP_011348630.1.39371 WP_011348630.1.40690 WP_011348630.1.43396 WP_011348630.1.44794 WP_011348630.1.46449 WP_011348630.1.46677 WP_011348630.1.49886 WP_011348630.1.55770 WP_011348630.1.60785 WP_011348630.1.64411 WP_011348630.1.66420 WP_011348630.1.67180 WP_011348630.1.67877 WP_011348630.1.75734 WP_011348630.1.772 WP_011348630.1.79359 WP_011348630.1.81489 WP_011348630.1.8544 WP_011348630.1.89212 WP_011348630.1.89360 WP_011348630.1.94946 WP_011348630.1.99285 316273.XCV3731 gi|78049287|ref|YP_365462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]