SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78049511|ref|YP_365686.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049511|ref|YP_365686.1|
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.87e-40
Family Thioltransferase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78049511|ref|YP_365686.1|
Sequence length 113
Comment thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVN
VDQNRALAIKYHVRSIPMLLLFKDGQVQATQIGAVGKGQLTQMIDKTLGGAAA
Download sequence
Identical sequences A0A099QCV0 A0A0A6TNV5 A0A0E3YP99 A0A0G8LGB6 A0A0G8YTR3 A0A0Q0HHS0 A0A0Q5GPV8 A0A1S1XMK5 A0A1T1P0T7 A0A1U8ZKN3 A0A1V9GT40 A0A220WD24 A0A221LWK0 A0A248YBB5 A0A2D2UGY3 D4SWY8 D4T488 F0C2H6 G2LW54 Q3BNH7 V7Z8D9
316273.XCV3955 WP_005923050.1.100156 WP_005923050.1.100312 WP_005923050.1.100431 WP_005923050.1.101491 WP_005923050.1.101846 WP_005923050.1.10442 WP_005923050.1.11230 WP_005923050.1.11469 WP_005923050.1.12827 WP_005923050.1.13735 WP_005923050.1.14032 WP_005923050.1.14073 WP_005923050.1.14159 WP_005923050.1.16263 WP_005923050.1.16412 WP_005923050.1.16695 WP_005923050.1.17112 WP_005923050.1.17148 WP_005923050.1.19776 WP_005923050.1.199 WP_005923050.1.20169 WP_005923050.1.21303 WP_005923050.1.21317 WP_005923050.1.22114 WP_005923050.1.2230 WP_005923050.1.2259 WP_005923050.1.22679 WP_005923050.1.23534 WP_005923050.1.24172 WP_005923050.1.24731 WP_005923050.1.2491 WP_005923050.1.25231 WP_005923050.1.25999 WP_005923050.1.26095 WP_005923050.1.27112 WP_005923050.1.29361 WP_005923050.1.3003 WP_005923050.1.30571 WP_005923050.1.30677 WP_005923050.1.31364 WP_005923050.1.3309 WP_005923050.1.331 WP_005923050.1.34035 WP_005923050.1.3440 WP_005923050.1.35545 WP_005923050.1.35849 WP_005923050.1.37259 WP_005923050.1.37569 WP_005923050.1.37942 WP_005923050.1.38766 WP_005923050.1.39297 WP_005923050.1.39341 WP_005923050.1.39371 WP_005923050.1.40308 WP_005923050.1.40689 WP_005923050.1.40690 WP_005923050.1.42602 WP_005923050.1.43379 WP_005923050.1.43396 WP_005923050.1.43419 WP_005923050.1.43567 WP_005923050.1.4389 WP_005923050.1.4391 WP_005923050.1.44794 WP_005923050.1.45479 WP_005923050.1.46449 WP_005923050.1.46677 WP_005923050.1.47244 WP_005923050.1.47958 WP_005923050.1.48351 WP_005923050.1.49137 WP_005923050.1.49886 WP_005923050.1.50405 WP_005923050.1.51091 WP_005923050.1.5224 WP_005923050.1.52489 WP_005923050.1.53125 WP_005923050.1.53650 WP_005923050.1.54158 WP_005923050.1.54709 WP_005923050.1.55132 WP_005923050.1.55770 WP_005923050.1.56262 WP_005923050.1.56360 WP_005923050.1.56692 WP_005923050.1.57452 WP_005923050.1.57989 WP_005923050.1.59630 WP_005923050.1.59767 WP_005923050.1.60785 WP_005923050.1.61221 WP_005923050.1.62152 WP_005923050.1.63850 WP_005923050.1.64411 WP_005923050.1.656 WP_005923050.1.66420 WP_005923050.1.67180 WP_005923050.1.6771 WP_005923050.1.67877 WP_005923050.1.6838 WP_005923050.1.68402 WP_005923050.1.71095 WP_005923050.1.71353 WP_005923050.1.72092 WP_005923050.1.72305 WP_005923050.1.72777 WP_005923050.1.74121 WP_005923050.1.7523 WP_005923050.1.75734 WP_005923050.1.76535 WP_005923050.1.772 WP_005923050.1.77810 WP_005923050.1.78066 WP_005923050.1.79359 WP_005923050.1.79878 WP_005923050.1.80975 WP_005923050.1.81489 WP_005923050.1.81620 WP_005923050.1.82045 WP_005923050.1.8245 WP_005923050.1.83628 WP_005923050.1.85024 WP_005923050.1.85152 WP_005923050.1.8544 WP_005923050.1.85778 WP_005923050.1.86099 WP_005923050.1.86317 WP_005923050.1.8677 WP_005923050.1.87054 WP_005923050.1.87207 WP_005923050.1.89212 WP_005923050.1.89360 WP_005923050.1.91306 WP_005923050.1.91667 WP_005923050.1.93028 WP_005923050.1.93402 WP_005923050.1.93448 WP_005923050.1.94781 WP_005923050.1.94946 WP_005923050.1.96073 WP_005923050.1.96800 WP_005923050.1.97233 WP_005923050.1.98824 WP_005923050.1.9928 WP_005923050.1.99285 gi|78049511|ref|YP_365686.1| gi|346726604|ref|YP_004853273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]