SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78049555|ref|YP_365730.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049555|ref|YP_365730.1|
Domain Number 1 Region: 79-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000295
Family Glutathione peroxidase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78049555|ref|YP_365730.1|
Sequence length 191
Comment hypothetical protein XCV3999 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MTSSTSATPHSVKRGRRMLIALAVLFFGSMLLAGVLRFSGWQPASMRNHGELLKPPADLR
ALVPVRANGQPYAWAPSERIWRIAVAPPADCTQQCVALAAELDKVWQLLGHRADKVEVLW
IGPPPAGLPPMPALRVLRDDARLRQALPRGTDAAGVPVYVIDPNGFVILRYAPGFDPAGL
RSDLVKLLKLM
Download sequence
Identical sequences G2LW98 Q3BND3
gi|346726648|ref|YP_004853317.1| WP_011348839.1.100156 WP_011348839.1.10442 WP_011348839.1.11230 WP_011348839.1.13735 WP_011348839.1.199 WP_011348839.1.21303 WP_011348839.1.21317 WP_011348839.1.2230 WP_011348839.1.2259 WP_011348839.1.23534 WP_011348839.1.27112 WP_011348839.1.29361 WP_011348839.1.3003 WP_011348839.1.331 WP_011348839.1.37942 WP_011348839.1.39371 WP_011348839.1.40690 WP_011348839.1.43396 WP_011348839.1.44794 WP_011348839.1.46449 WP_011348839.1.46677 WP_011348839.1.49886 WP_011348839.1.55770 WP_011348839.1.60785 WP_011348839.1.64411 WP_011348839.1.66420 WP_011348839.1.67180 WP_011348839.1.67877 WP_011348839.1.68402 WP_011348839.1.75734 WP_011348839.1.772 WP_011348839.1.79359 WP_011348839.1.81489 WP_011348839.1.8544 WP_011348839.1.89212 WP_011348839.1.89360 WP_011348839.1.94946 WP_011348839.1.99285 gi|78049555|ref|YP_365730.1| 316273.XCV3999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]