SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78049693|ref|YP_365868.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049693|ref|YP_365868.1|
Domain Number 1 Region: 78-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78049693|ref|YP_365868.1|
Sequence length 229
Comment glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MIDLYYWPTPNGHKVTLFLEEAGLQYTLKPVNIGKGEQFEPAFLQISPNNKMPAIVDHAP
ADGGGAQSVFESGAILLYLAEKTGRFLPRDARGRIAALEWLFWQMGGLGPMSGQMGHFNV
YAPEKIAYAIERYNAEVRRLHGVLDKRLADHAFLAGNDYGIADMASYPWIEVYGDLKPDY
SAFPHLKRWHDAIAARPATQRAYALKEQVNPNAGQPLSDEERKHLFGKR
Download sequence
Identical sequences A0A0G9DJF6 A0A1S1XJM7 G2LXQ6 Q3BMZ5
gi|78049693|ref|YP_365868.1| 316273.XCV4137 WP_008576488.1.100156 WP_008576488.1.100312 WP_008576488.1.10442 WP_008576488.1.11230 WP_008576488.1.12827 WP_008576488.1.13735 WP_008576488.1.14159 WP_008576488.1.16263 WP_008576488.1.17112 WP_008576488.1.19776 WP_008576488.1.199 WP_008576488.1.20169 WP_008576488.1.21303 WP_008576488.1.21317 WP_008576488.1.2230 WP_008576488.1.2259 WP_008576488.1.23534 WP_008576488.1.24172 WP_008576488.1.25231 WP_008576488.1.27112 WP_008576488.1.29361 WP_008576488.1.3003 WP_008576488.1.30677 WP_008576488.1.331 WP_008576488.1.3440 WP_008576488.1.37569 WP_008576488.1.37942 WP_008576488.1.39371 WP_008576488.1.40690 WP_008576488.1.43396 WP_008576488.1.43419 WP_008576488.1.44794 WP_008576488.1.46449 WP_008576488.1.46677 WP_008576488.1.47244 WP_008576488.1.47958 WP_008576488.1.48351 WP_008576488.1.49886 WP_008576488.1.50405 WP_008576488.1.51091 WP_008576488.1.5224 WP_008576488.1.54158 WP_008576488.1.54709 WP_008576488.1.55770 WP_008576488.1.56262 WP_008576488.1.57452 WP_008576488.1.59767 WP_008576488.1.60785 WP_008576488.1.61221 WP_008576488.1.64411 WP_008576488.1.656 WP_008576488.1.66420 WP_008576488.1.67180 WP_008576488.1.67877 WP_008576488.1.6838 WP_008576488.1.68402 WP_008576488.1.72305 WP_008576488.1.75734 WP_008576488.1.772 WP_008576488.1.77810 WP_008576488.1.78066 WP_008576488.1.79359 WP_008576488.1.79878 WP_008576488.1.80975 WP_008576488.1.81489 WP_008576488.1.85024 WP_008576488.1.85152 WP_008576488.1.8544 WP_008576488.1.86099 WP_008576488.1.89212 WP_008576488.1.89360 WP_008576488.1.94781 WP_008576488.1.94946 WP_008576488.1.96073 WP_008576488.1.9928 WP_008576488.1.99285 gi|346726780|ref|YP_004853449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]