SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78050013|ref|YP_366188.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78050013|ref|YP_366188.1|
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-56
Family Glutathione peroxidase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78050013|ref|YP_366188.1|
Sequence length 183
Comment glutathione peroxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSQTLYDIPVTRIDGQPTTLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRMQGLEV
LGFPANDFNAQEPGSEAEIAQFCQLTYDVTFPMFAKIAVTGDQAHPLYRALTSTHPHTTG
DGPMREKLAGYGIAPNPAPGVVWNFEKFLIGRDGKIVDRFAPDIPADDARLRAAVDAALA
THA
Download sequence
Identical sequences Q3BM25
316273.XCV4457 gi|78050013|ref|YP_366188.1| WP_011349193.1.100156 WP_011349193.1.10442 WP_011349193.1.11230 WP_011349193.1.13735 WP_011349193.1.199 WP_011349193.1.21303 WP_011349193.1.21317 WP_011349193.1.2259 WP_011349193.1.23534 WP_011349193.1.27112 WP_011349193.1.29361 WP_011349193.1.3003 WP_011349193.1.37942 WP_011349193.1.39371 WP_011349193.1.40690 WP_011349193.1.43396 WP_011349193.1.44794 WP_011349193.1.46449 WP_011349193.1.46677 WP_011349193.1.49886 WP_011349193.1.55770 WP_011349193.1.60785 WP_011349193.1.64411 WP_011349193.1.66420 WP_011349193.1.67180 WP_011349193.1.67877 WP_011349193.1.75734 WP_011349193.1.772 WP_011349193.1.79359 WP_011349193.1.81489 WP_011349193.1.89212 WP_011349193.1.89360 WP_011349193.1.94946 WP_011349193.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]