SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78045734|ref|YP_361909.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78045734|ref|YP_361909.1|
Domain Number 1 Region: 66-257
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.28e-38
Family Phospholipase D 0.033
Further Details:      
 
Domain Number 2 Region: 313-419,514-590
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.67e-23
Family Nuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78045734|ref|YP_361909.1|
Sequence length 672
Comment phospholipase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKCLLRVCVLATLLLGTGCASLSQTERNRAAGVAAAARSTVVNCSQADRCAQPSPLRALG
GEAMTASTPAAPRHYATIVDHGEESLVARLNLIRSATRSIDLQTYIFDKDDSARMVLDAL
VDAAQRGVKVRILIDQLSAIADLQILGALASSHENLQLRIYNPTFGKVKLNYFDYAGSVL
CCFRRFNQRMHNKLLVVDDVLGVVGGRNYQDDYYDWDSEYNFRDRDVILAGPEVRAMAAN
FDAFWRARRSVPAERLNDVGRLLLEQGVPTMPPAEFRRPDRVARVDREVRDPQFVRDAFV
TPAMPVQRVLYVADLPQKHRREHAAKAVSTAPELDGLIAGAQQEVLLQTPYLVLSDQAQA
IFRTLRKHPQPPRIVVSTNSLAATDNPIVYALSYKFKRRNMRELGFNVYEFKPFPLDAPV
DYANLVPDPLNPASEVNRDSRNNRLIGGSAAGNAMRGSSGPEGNASASAGSVLRGSGGGR
APGGSEVDRRVLRTETRPSFLGTRAVNKPLPVTRAGARMGLHAKSLVVDRRIGVIGTHNF
DPRSENYNTEAAVVIDDARFAQALAASIERDVAPENAWTVAPREKPPVLSGLNYSVGKVS
EALPVLDFWPWRYATNYEFQPGPDCPFPLKRQDPQFRQCYVAVGDFPEVNVGPKWLLVRM
LTAFGAGLVPIL
Download sequence
Identical sequences Q3BZA4
WP_011345911.1.100156 WP_011345911.1.10442 WP_011345911.1.11230 WP_011345911.1.13735 WP_011345911.1.14159 WP_011345911.1.19776 WP_011345911.1.199 WP_011345911.1.21303 WP_011345911.1.2259 WP_011345911.1.23534 WP_011345911.1.24172 WP_011345911.1.25231 WP_011345911.1.27112 WP_011345911.1.29361 WP_011345911.1.3003 WP_011345911.1.3440 WP_011345911.1.37942 WP_011345911.1.39371 WP_011345911.1.40690 WP_011345911.1.43396 WP_011345911.1.44794 WP_011345911.1.46449 WP_011345911.1.46677 WP_011345911.1.47244 WP_011345911.1.49886 WP_011345911.1.54158 WP_011345911.1.55770 WP_011345911.1.56262 WP_011345911.1.60785 WP_011345911.1.61221 WP_011345911.1.64411 WP_011345911.1.656 WP_011345911.1.66420 WP_011345911.1.67180 WP_011345911.1.67877 WP_011345911.1.75734 WP_011345911.1.772 WP_011345911.1.78066 WP_011345911.1.79359 WP_011345911.1.79878 WP_011345911.1.81489 WP_011345911.1.8544 WP_011345911.1.86099 WP_011345911.1.89212 WP_011345911.1.89360 WP_011345911.1.94946 WP_011345911.1.99285 316273.XCV0178 gi|78045734|ref|YP_361909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]