SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046036|ref|YP_362211.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046036|ref|YP_362211.1|
Domain Number 1 Region: 54-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-18
Family Thioltransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78046036|ref|YP_362211.1|
Sequence length 196
Comment thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MPIKPLVCGLLLTGLLSACGQTSSPQEAPKPLDTSMQKPPSADPSQPVSSGNTPTAADIA
AAAALNAQYDPSRDPAADLETAKVEAKRGGKRIVLNVGNAACEPCKALDELMGGDAELRS
FRDAHFVVVKVNRDAANENAAFLSAFAQLNDAPSLLVLDSDGKLLTTQSGPELRKGEGFD
RKKLFDFLKQWAPPQA
Download sequence
Identical sequences A0A0G9AE99 A0A1S1XPM9 A0A1V9HQ46 G2M1M3 Q3BYF2
WP_008575538.1.100156 WP_008575538.1.100312 WP_008575538.1.10442 WP_008575538.1.11230 WP_008575538.1.12827 WP_008575538.1.13735 WP_008575538.1.14159 WP_008575538.1.16263 WP_008575538.1.17112 WP_008575538.1.19776 WP_008575538.1.199 WP_008575538.1.20169 WP_008575538.1.21303 WP_008575538.1.21317 WP_008575538.1.2230 WP_008575538.1.2259 WP_008575538.1.23534 WP_008575538.1.24172 WP_008575538.1.25231 WP_008575538.1.27112 WP_008575538.1.29361 WP_008575538.1.3003 WP_008575538.1.30677 WP_008575538.1.331 WP_008575538.1.3440 WP_008575538.1.37569 WP_008575538.1.37942 WP_008575538.1.39371 WP_008575538.1.40690 WP_008575538.1.43396 WP_008575538.1.43419 WP_008575538.1.44794 WP_008575538.1.46677 WP_008575538.1.47244 WP_008575538.1.47958 WP_008575538.1.48351 WP_008575538.1.49886 WP_008575538.1.50405 WP_008575538.1.51091 WP_008575538.1.5224 WP_008575538.1.54158 WP_008575538.1.54709 WP_008575538.1.55770 WP_008575538.1.56262 WP_008575538.1.57452 WP_008575538.1.59767 WP_008575538.1.60785 WP_008575538.1.61221 WP_008575538.1.64411 WP_008575538.1.656 WP_008575538.1.66420 WP_008575538.1.67180 WP_008575538.1.67877 WP_008575538.1.6838 WP_008575538.1.68402 WP_008575538.1.72305 WP_008575538.1.75734 WP_008575538.1.772 WP_008575538.1.77810 WP_008575538.1.78066 WP_008575538.1.79359 WP_008575538.1.79878 WP_008575538.1.80975 WP_008575538.1.81489 WP_008575538.1.85024 WP_008575538.1.85152 WP_008575538.1.8544 WP_008575538.1.86099 WP_008575538.1.89212 WP_008575538.1.89360 WP_008575538.1.94781 WP_008575538.1.94946 WP_008575538.1.96073 WP_008575538.1.9928 WP_008575538.1.99285 gi|346723381|ref|YP_004850050.1| gi|78046036|ref|YP_362211.1| 316273.XCV0480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]