SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046123|ref|YP_362298.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046123|ref|YP_362298.1|
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 2.48e-35
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00018
Further Details:      
 
Domain Number 2 Region: 199-315
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.57e-30
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00047
Further Details:      
 
Domain Number 3 Region: 669-768
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000397
Family Thioltransferase 0.011
Further Details:      
 
Weak hits

Sequence:  gi|78046123|ref|YP_362298.1|
Domain Number - Region: 377-548
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0863
Family ABC transporter transmembrane region 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78046123|ref|YP_362298.1|
Sequence length 772
Comment C-type cytochrome biogenesis protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKSLSRWIARCALLAAPLLAAPLAVLAPAPAQAAVTEADLLPVDQAFALSATADSRDRIA
LHWKIAPGYYLYRHRISVKAGKGFAAGELALPEGESKHDEFFGQVQTYRKQLQATLAGKA
DPAVQTAVLQVQYQGCADAGVCYPPQRREIRLDLPAADATGAQATAAPRENLGALVPRNA
AAPRLFGAPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGYYIYRDRTSLALE
GANGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDHPDPAHVTLVATFQGCQT
DGICYPPMTRRVALDVPAGTVSPQNQAQAAPLMISPLAAGQAPVEPAPAASTAVPVADAS
AGNPERTPPPHTDKGLLGMLVLALLGGLVLNLMPCVLPILSLKVLGLAHSGESRSHARSH
AIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFT
LGTNLGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFL
VLGLGLALPFLLIGFVPSLARRLPTPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDA
LALMLVGATLLALGLWCFERSRWKSHRLGMGLATTMLVLALVPVVAVTRLSLPAATAAEG
VVAFSPQLLDRLRADNRVVFVNMTADWCVTCKANEKNVLSSAEFRDALRRVDAVYMKGDW
TNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR
Download sequence
Identical sequences Q3BY65
gi|78046123|ref|YP_362298.1| WP_011346209.1.100156 WP_011346209.1.10442 WP_011346209.1.11230 WP_011346209.1.13735 WP_011346209.1.199 WP_011346209.1.20169 WP_011346209.1.21303 WP_011346209.1.21317 WP_011346209.1.2259 WP_011346209.1.23534 WP_011346209.1.27112 WP_011346209.1.29361 WP_011346209.1.3003 WP_011346209.1.37942 WP_011346209.1.39371 WP_011346209.1.40690 WP_011346209.1.43396 WP_011346209.1.44794 WP_011346209.1.46677 WP_011346209.1.49886 WP_011346209.1.55770 WP_011346209.1.60785 WP_011346209.1.64411 WP_011346209.1.66420 WP_011346209.1.67180 WP_011346209.1.67877 WP_011346209.1.75734 WP_011346209.1.772 WP_011346209.1.79359 WP_011346209.1.81489 WP_011346209.1.8544 WP_011346209.1.89212 WP_011346209.1.89360 WP_011346209.1.94946 WP_011346209.1.99285 316273.XCV0567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]